TkA08G112580 | RubberDandelionOmics

Gene overview

TkA08G112580

Reference: TK1151 Chr: Chr08 Coordinates: 29298394-29299816 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

819 bp · TkA08G112580|TK1151|cDNA

ATGACTTATGTTGTTTGGTGTCTTTCAACAGGAGATCTTGGTCAAACGTTTGACTCAAACCAAACTTTAACTCATTACGAGTCAAACCCTATAAAAGGGAATGGGGTGTTGTTTGTTGGAGACCTTTCCTATGCAGATAAGTATCCATTGCATGATAATAATAGGTGGGATTCATGGGGAAGGTTTTTAGAAAGAAGTGTTGCTTACCAACCCTGGATTTGGAGTGCCGGTAATCATGAATCGATTTTCTTCCTGATTAT...

CDS

Download CDS FASTA

819 bp · TkA08G112580|TK1151|CDS

ATGACTTATGTTGTTTGGTGTCTTTCAACAGGAGATCTTGGTCAAACGTTTGACTCAAACCAAACTTTAACTCATTACGAGTCAAACCCTATAAAAGGGAATGGGGTGTTGTTTGTTGGAGACCTTTCCTATGCAGATAAGTATCCATTGCATGATAATAATAGGTGGGATTCATGGGGAAGGTTTTTAGAAAGAAGTGTTGCTTACCAACCCTGGATTTGGAGTGCCGGTAATCATGAATCGATTTTCTTCCTGATTAT...

Protein

Download Protein FASTA

272 aa · TkA08G112580|TK1151|PROTEIN

MTYVVWCLSTGDLGQTFDSNQTLTHYESNPIKGNGVLFVGDLSYADKYPLHDNNRWDSWGRFLERSVAYQPWIWSAGNHESIFFLIMGEGEPFKPYTHRYCVPYKASGSTSPLWYSIKRASAYIIVMSSYSAYGKSTPQYKWLMSELPKVNRSETPWLIVVMHCPLYSTYVHHYMEGETMRVMYEQYFVQYKVDVVFSGHVHAYERTERVSNIVYNIENGLCTPRKDTFAPVYITIGDGGNQEGLLYEYVVLFLCDLLKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G112580`
TK1151 ID	TkA08G112580
OH-1004 ID	LXL04_031543
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	89.700
Protein coverage (%)	TK1151 89.338 / OH-1004 49.091 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G112580

Location Chr08:29298394-29299816 (+)

Description Similar to PAP2: Purple acid phosphatase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27190`	Fe(3+)-Zn(2+) purple acid phosphatase 12.	No verified direct reference in this release
`At2g16430`	Purple acid phosphatase 10.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031543 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0003993 acid phosphatase activity Molecular Function

GO:0030145 manganese ion binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G16430

ath:AT2G27190

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.368

Rank 1 · TkA08G112580 · TK1151

Cytoplasm0.225

Rank 2 · TkA08G112580 · TK1151

Extracellular0.215

Rank 3 · TkA08G112580 · TK1151

Endoplasmic reticulum0.178

Rank 4 · TkA08G112580 · TK1151

Cell membrane0.119

Rank 5 · TkA08G112580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13788DUF41803-46 aa

PF00149Metallophos10-204 aa

PF14008Metallophos_C75-97 aa

PF07356DUF1481109-163 aa

PF13788DUF4180186-220 aa

PF14008Metallophos_C230-244 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G112580	`PF13788`	DUF4180	3	46	0.13	13.0
TkA08G112580	`PF00149`	Metallophos	10	204	1.1e-22	82.2
TkA08G112580	`PF14008`	Metallophos_C	75	97	0.00035	21.9
TkA08G112580	`PF07356`	DUF1481	109	163	0.094	13.2
TkA08G112580	`PF13788`	DUF4180	186	220	0.13	13.0
TkA08G112580	`PF14008`	Metallophos_C	230	244	0.00035	21.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38924`	Arabidopsis thaliana	sp\|Q38924\|PPA12_ARATH Fe(3+)-Zn(2+) purple acid phosphatase 12	76.500%	Swiss-Prot	High
`Q9SIV9`	Arabidopsis thaliana	sp\|Q9SIV9\|PPA10_ARATH Purple acid phosphatase 10	74.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card