TkA08G112160 | RubberDandelionOmics

Gene overview

TkA08G112160

Reference: TK1151 Chr: Chr08 Coordinates: 29171257-29176263 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4152 bp · TkA08G112160|TK1151|cDNA

TTATTTTACAAAACTGATCTTCACATTCTCAGATCTAACACTGTTTTTAACACACACTGCATCAATCCCCGGCTACTCTTTCGTTTTCTCTGCCTCTCTTCCCCCAAATGCCTTATGATCACAAGTATACTGCTCTTTAATCATCACAGCGGATCGATCGATCGAATAATTCATCGAATTAACAGCATTTAATTCTCAGATCTAAGAGGTTGGGGACGAAACGCAGCGAAGATGTTGACGAAATTTGAGACGAAGAGTAA...

CDS

Download CDS FASTA

3651 bp · TkA08G112160|TK1151|CDS

ATGTTGACGAAATTTGAGACGAAGAGTAATAGAGTTAAAGGTTTGAGTTTCCACAGCAAGAGGCCATGGATCTTGGCCAGTCTTCACAGTGGTGTGATCCAGCTATGGGATTACAGGATGGGCACTCTCATTGATCGTTTTGACGAGCATGATGGCCCTGTTCGTGGCGTGCACTTTCATCAATCACAGCCTCTGTTCGTTTCGGGAGGAGATGATTACAAGATCAAAGTATGGAACTACAAACTGCACCGGTGCTTATT...

Protein

Download Protein FASTA

1216 aa · TkA08G112160|TK1151|PROTEIN

MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHQSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCALFHPKEDLVVSASLDQTVRVWDIGALKKKTVSPADDILRLSQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHARQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G112160`
TK1151 ID	TkA08G112160
OH-1004 ID	LXL04_030517
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	86.000
Protein coverage (%)	TK1151 100.000 / OH-1004 99.835 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G112160

Location Chr08:29171257-29176263 (+)

Description Similar to At1g62020: Coatomer subunit alpha-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g62020`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release
`At2g21390`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0127800`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release
`Os03g0711400`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release
`Os03g0711500`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030517 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process

GO:0006891 intra-Golgi vesicle-mediated transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0030126 COPI vesicle coat Cellular Component

GO:0005198 structural molecule activity Molecular Function

KEGG gene cross-reference

ath:AT1G62020

ath:AT2G21390

dosa:Os03g0711400

dosa:Os03g0711500

dosa:Os09g0127800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.565

Rank 1 · TkA08G112160 · TK1151

Nucleus0.294

Rank 2 · TkA08G112160 · TK1151

Golgi apparatus0.124

Rank 3 · TkA08G112160 · TK1151

Lysosome / Vacuole0.098

Rank 4 · TkA08G112160 · TK1151

Endoplasmic reticulum0.089

Rank 5 · TkA08G112160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25171Beta-prop_WDR36-Utp21_1st2-79 aa

PF25175Beta-prop_WDR53-90 aa

PF25173Beta-prop_WDR3_1st4-164 aa

PF00400WD404-37 aa

PF25168Beta-prop_WDR36-Utp21_2nd4-47 aa

PF24796WDR554-167 aa

PF24807WD40_CDC20-Fz4-162 aa

PF24805EIF3I4-81 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G112160	`PF25171`	Beta-prop_WDR36-Utp21_1st	2	79	6.5e-20	72.4
TkA08G112160	`PF25175`	Beta-prop_WDR5	3	90	1.1e-56	193.0
TkA08G112160	`PF25173`	Beta-prop_WDR3_1st	4	164	3.9e-52	177.3
TkA08G112160	`PF00400`	WD40	4	37	3.5e-49	163.9
TkA08G112160	`PF25168`	Beta-prop_WDR36-Utp21_2nd	4	47	4.6e-27	95.9
TkA08G112160	`PF24796`	WDR55	4	167	1.4e-24	87.4
TkA08G112160	`PF24807`	WD40_CDC20-Fz	4	162	5.6e-24	85.7
TkA08G112160	`PF24805`	EIF3I	4	81	3.6e-19	69.8
TkA08G112160	`PF23798`	Beta-prop_SPT8	4	85	1.6e-05	24.7
TkA08G112160	`PF23393`	Beta-prop_WDR90_POC16_2nd	5	68	2.2e-16	60.7
TkA08G112160	`PF25174`	Beta-prop_THOC3	6	127	8.8e-44	150.3
TkA08G112160	`PF24814`	WD40_Prp19	7	59	1.5e-44	152.9
TkA08G112160	`PF12894`	ANAPC4_WD40	7	59	1.3e-08	35.6
TkA08G112160	`PF23775`	Beta-prop_RIG_2nd	7	59	1.5e-05	25.3
TkA08G112160	`PF23410`	Beta-prop_VPS8	7	72	0.0043	16.8
TkA08G112160	`PF23756`	Beta-prop_HPS5	7	82	0.037	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94A40`	Arabidopsis thaliana	sp\|Q94A40\|COPA1_ARATH Coatomer subunit alpha-1	82.900%	Swiss-Prot	High
`Q9SJT9`	Arabidopsis thaliana	sp\|Q9SJT9\|COPA2_ARATH Coatomer subunit alpha-2	81.700%	Swiss-Prot	High
`Q0J3D9`	Oryza sativa subsp. japonica	sp\|Q0J3D9\|COPA3_ORYSJ Coatomer subunit alpha-3	79.000%	Swiss-Prot	High
`Q9AUR8`	Oryza sativa subsp. japonica	sp\|Q9AUR8\|COPA1_ORYSJ Coatomer subunit alpha-1	78.700%	Swiss-Prot	High
`Q9AUR7`	Oryza sativa subsp. japonica	sp\|Q9AUR7\|COPA2_ORYSJ Coatomer subunit alpha-2	78.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card