TkA08G110140 | RubberDandelionOmics

Gene overview

TkA08G110140

Reference: TK1151 Chr: Chr08 Coordinates: 28657623-28658721 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

809 bp · TkA08G110140|TK1151|cDNA

CCTCCTCTTCTACAACCTCCTTAAACCCTAAAATCAAAACTTGAGCGTATAAACCCTATTTCTCCTATAGCCTCCTTGATTTCGCGATTCATAACAAAGACATGGGTGGAAGCGATAGTGAAGTAGAGAAATCGGCACGCAAGGAGAACGAGAAGAAGAAGCTTCTGGCATTAGCTCCAATCGCTAAACCCCTTGCTGGCAAGAAACTCTCCAAACGTACACTCAAACTCGTCCGCAAAGCTGCCGAACACAAATGCTTA...

CDS

Download CDS FASTA

477 bp · TkA08G110140|TK1151|CDS

ATGGGTGGAAGCGATAGTGAAGTAGAGAAATCGGCACGCAAGGAGAACGAGAAGAAGAAGCTTCTGGCATTAGCTCCAATCGCTAAACCCCTTGCTGGCAAGAAACTCTCCAAACGTACACTCAAACTCGTCCGCAAAGCTGCCGAACACAAATGCTTAAAGCGAGGAGTTAAGGAGGTCGTGAAGAGCATCAGACGCGGCAATAAAGGAGTGTGTGTTATTGCTGGAAACATAACTCCAATTGATGTGATAACTCATGT...

Protein

Download Protein FASTA

158 aa · TkA08G110140|TK1151|PROTEIN

MGGSDSEVEKSARKENEKKKLLALAPIAKPLAGKKLSKRTLKLVRKAAEHKCLKRGVKEVVKSIRRGNKGVCVIAGNITPIDVITHVPILCEEAEIPYVYVTSKEDLANAGATKRPTCCVLVLSKPTKGELAEEIQKKLKTEYDEVSTEITSLAASMF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G110140`
TK1151 ID	TkA08G110140
OH-1004 ID	LXL04_031496
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G110140

Location Chr08:28657623-28658721 (-)

Description Similar to At5g08180: H/ACA ribonucleoprotein complex subunit 2-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08180`	Required for ribosome biogenesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031496 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000454 snoRNA guided rRNA pseudouridine synthesis Biological Process

GO:0000493 box H/ACA snoRNP assembly Biological Process

GO:0006364 rRNA processing Biological Process

GO:0007004 telomere maintenance via telomerase Biological Process

GO:0031118 rRNA pseudouridine synthesis Biological Process

GO:0031120 snRNA pseudouridine synthesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005697 telomerase holoenzyme complex Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005732 sno(s)RNA-containing ribonucleoprotein complex Cellular Component

GO:0031429 box H/ACA snoRNP complex Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G08180

sce:YDL208W

spo:2542369

xtr:394586

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.655

Rank 1 · TkA08G110140 · TK1151

Nucleus0.316

Rank 2 · TkA08G110140 · TK1151

Cell membrane0.162

Rank 3 · TkA08G110140 · TK1151

Mitochondrion0.078

Rank 4 · TkA08G110140 · TK1151

Endoplasmic reticulum0.053

Rank 5 · TkA08G110140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23871DUF722614-64 aa

PF01248Ribosomal_L7Ae16-25 aa

PF25416GRHL1_C36-73 aa

PF01248Ribosomal_L7Ae41-124 aa

PF25416GRHL1_C121-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G110140	`PF23871`	DUF7226	14	64	0.1	13.2
TkA08G110140	`PF01248`	Ribosomal_L7Ae	16	25	6.9e-24	84.1
TkA08G110140	`PF25416`	GRHL1_C	36	73	0.15	12.7
TkA08G110140	`PF01248`	Ribosomal_L7Ae	41	124	6.9e-24	84.1
TkA08G110140	`PF25416`	GRHL1_C	121	147	0.15	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LEY9`	Arabidopsis thaliana	sp\|Q9LEY9\|NHP2_ARATH H/ACA ribonucleoprotein complex subunit 2-like protein	72.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card