TkA08G109860 | RubberDandelionOmics

Gene overview

TkA08G109860

Reference: TK1151 Chr: Chr08 Coordinates: 28571256-28571795 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

540 bp · TkA08G109860|TK1151|cDNA

ATGGCTCGACACGTGTGCATCTCAGTCGGTGGTGTGTATGTGTGTTTCGGAAGTCAAGCGGTGTTGACCAACGAACAGATGGAGGAGGTGGCGCTGGGGTTGGAAAAAAGCCTCGTGAACTTTGTGTGGTCGGTGAAAGAACCTACCGCCGGACACGTGACCGGAAAATACGGGAAGCTACCTGCAGGTTTCGAGGAACGTGTGGCCGGTAGGGGGCTAGTTGTTAAAGGGTGGGCGCCGCAGGTAGCCATTCTGAGTCA...

CDS

Download CDS FASTA

540 bp · TkA08G109860|TK1151|CDS

ATGGCTCGACACGTGTGCATCTCAGTCGGTGGTGTGTATGTGTGTTTCGGAAGTCAAGCGGTGTTGACCAACGAACAGATGGAGGAGGTGGCGCTGGGGTTGGAAAAAAGCCTCGTGAACTTTGTGTGGTCGGTGAAAGAACCTACCGCCGGACACGTGACCGGAAAATACGGGAAGCTACCTGCAGGTTTCGAGGAACGTGTGGCCGGTAGGGGGCTAGTTGTTAAAGGGTGGGCGCCGCAGGTAGCCATTCTGAGTCA...

Protein

Download Protein FASTA

179 aa · TkA08G109860|TK1151|PROTEIN

MARHVCISVGGVYVCFGSQAVLTNEQMEEVALGLEKSLVNFVWSVKEPTAGHVTGKYGKLPAGFEERVAGRGLVVKGWAPQVAILSHDAVCAFLTHCGWNSIMEAVAAGVLMLTWPMSADQFSNATLLQELKVGIRASEGPETVPDSGELAELFSKSLSEKTRVKESERRSLRGRQRKQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G109860`
TK1151 ID	TkA08G109860
OH-1004 ID	LXL04_030557
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	50.900
Protein coverage (%)	TK1151 86.592 / OH-1004 15.505 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G109860

Location Chr08:28571256-28571795 (+)

Description Similar to UGT89B1: Flavonol 3-O-glucosyltransferase UGT89B1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73880`	Possesses quercetin 3-O-glucosyltransferase, 7-O-glucosyltransferase and 4'-O-glucosyltransferase activities in vitro.	No verified direct reference in this release
`At5g03490`	Glucosyltransferase that glucosylates benzoates and benzoate derivatives in vitro.	No verified direct reference in this release
`At1g06000`	May catalyze rhamnosyl transfer to flavonols.	Identification of a flavonol 7-O-rhamnosyltransferase gene determining flavonoid pattern in Arabidopsis by transcriptome coexpression analysis and reverse genetics.2007 · DOI: 10.1074/jbc.m611498200 Regioselective synthesis of flavonoid bisglycosides using Escherichia coli harboring two glycosyltransferases.2013 · DOI: 10.1007/s00253-013-4844-7 Expanded acceptor substrates flexibility study of flavonol 7-O-rhamnosyltransferase, AtUGT89C1 from Arabidopsis thaliana.2015 · DOI: 10.1016/j.carres.2015.09.010 7-Rhamnosylated Flavonols Modulate Homeostasis of the Plant Hormone Auxin and Affect Plant Development.2016 · DOI: 10.1074/jbc.m115.701565 Crystal structures of rhamnosyltransferase UGT89C1 from Arabidopsis thaliana reveal the molecular basis of sugar donor specificity for UDP-β-l-rhamnose and rhamnosylation mechanism.2019 · DOI: 10.1111/tpj.14321
`At4g34131`	Possesses quercetin 3-O-glucosyltransferase activity in vitro.	Pathogen-responsive expression of glycosyltransferase genes UGT73B3 and UGT73B5 is necessary for resistance to Pseudomonas syringae pv tomato in Arabidopsis.2005 · DOI: 10.1104/pp.105.067223

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030557 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:1901734 quercetin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0008194 UDP-glycosyltransferase activity Molecular Function

GO:0033836 flavonol 7-O-beta-glucosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0047893 flavonol 3-O-glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

GO:0080046 quercetin 4'-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G73880

ath:AT5G03490

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.421

Rank 1 · TkA08G109860 · TK1151

Peroxisome0.262

Rank 2 · TkA08G109860 · TK1151

Nucleus0.116

Rank 3 · TkA08G109860 · TK1151

Endoplasmic reticulum0.105

Rank 4 · TkA08G109860 · TK1151

Plastid0.105

Rank 5 · TkA08G109860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201UDPGT10-134 aa

PF04101Glyco_tran_28_C23-168 aa

PF06722EryCIII-like_C77-140 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G109860	`PF00201`	UDPGT	10	134	7.8e-19	68.6
TkA08G109860	`PF04101`	Glyco_tran_28_C	23	168	0.0021	18.8
TkA08G109860	`PF06722`	EryCIII-like_C	77	140	0.0021	18.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9B0`	Arabidopsis thaliana	sp\|Q9C9B0\|U89B1_ARATH Flavonol 3-O-glucosyltransferase UGT89B1	64.400%	Swiss-Prot	High
`Q9LZD8`	Arabidopsis thaliana	sp\|Q9LZD8\|U89A2_ARATH UDP-glycosyltransferase 89A2	52.700%	Swiss-Prot	High
`Q9LNE6`	Arabidopsis thaliana	sp\|Q9LNE6\|U89C1_ARATH Flavonol 7-O-rhamnosyltransferase	46.800%	Swiss-Prot	Medium
`Q8W491`	Arabidopsis thaliana	sp\|Q8W491\|U73B3_ARATH UDP-glycosyltransferase 73B3	52.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card