TkA08G108180 | RubberDandelionOmics

Gene overview

TkA08G108180

Reference: TK1151 Chr: Chr08 Coordinates: 28134817-28136668 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1429 bp · TkA08G108180|TK1151|cDNA

CACCAATTAAGCTGTCATTCCTCTAGCCTATATAACAGATGTAAGGACTCTCAACTTCATCACTCAGAAAATCCTCTTTGTCTCTCTCAAAATGTCTACTTCATCAGTTATTTACAGTACTCTACCTTCGTCTTCATCTGTACTCAACTTCCCCATCTTCCTTTGTACTATTGTCTTCGTCTCCATTTTTGCTTTCATCCTTGCTCCAGGTGGCCTCGCATGGTCTCTGTCAAAACGATCAAAATCCGCCATTCCTGGAC...

CDS

Download CDS FASTA

1338 bp · TkA08G108180|TK1151|CDS

ATGTCTACTTCATCAGTTATTTACAGTACTCTACCTTCGTCTTCATCTGTACTCAACTTCCCCATCTTCCTTTGTACTATTGTCTTCGTCTCCATTTTTGCTTTCATCCTTGCTCCAGGTGGCCTCGCATGGTCTCTGTCAAAACGATCAAAATCCGCCATTCCTGGACCCACTGGTTACCCTATTTTAGGCCTCGTGTTCGCGTTTACGTCATCTTTAACACACAGAACCCTAGCTAAGCTCTCGACCACCTTCAATGC...

Protein

Download Protein FASTA

446 aa · TkA08G108180|TK1151|PROTEIN

MSTSSVIYSTLPSSSSVLNFPIFLCTIVFVSIFAFILAPGGLAWSLSKRSKSAIPGPTGYPILGLVFAFTSSLTHRTLAKLSTTFNAKPLMAFSVGFTRFIISSHPETAKEILSSSAFADRPVKESAYELLFHRAMGFAPYGDYWRNLRRISSTHLFSPKRVYGFGVFRQNIGLKMADQVSSSMENNGVVEVKKILHFASLNNVMMSVFGKSYDDFHVGDGYVLEKLVSEGYELLGIFNWSDHFPIVSWFDFQGVRKRCR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G108180`
TK1151 ID	TkA08G108180
OH-1004 ID	LXL04_008714
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	81.700
Protein coverage (%)	TK1151 96.637 / OH-1004 83.815 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G108180

Location Chr08:28134817-28136668 (+)

Description Similar to CYP78A5: Cytochrome P450 78A5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13710`	Plays a role in regulating directional growth at the meristem/organ boundary.	CYP78A5 encodes a cytochrome P450 that marks the shoot apical meristem boundary in Arabidopsis.1999 · DOI: 10.1046/j.1365-313x.1999.00523.x Control of plant organ size by KLUH/CYP78A5-dependent intercellular signaling.2007 · DOI: 10.1016/j.devcel.2007.10.001 Dual effects of miR156-targeted SPL genes and CYP78A5/KLUH on plastochron length and organ size in Arabidopsis thaliana.2008 · DOI: 10.1105/tpc.108.058180 KLUH/CYP78A5-dependent growth signaling coordinates floral organ growth in Arabidopsis.2010 · DOI: 10.1016/j.cub.2010.01.039
`At2g46660`	Plays a role in seed and fruit development.	Maternal control of seed size by EOD3/CYP78A6 in Arabidopsis thaliana.2012 · DOI: 10.1111/j.1365-313x.2012.04907.x
`At3g61880`	Plays a role in seed and fruit development.	Overexpression of a gene encoding a cytochrome P450, CYP78A9, induces large and seedless fruit in arabidopsis.2000 · DOI: 10.1105/tpc.12.9.1541 Maternal control of seed size by EOD3/CYP78A6 in Arabidopsis thaliana.2012 · DOI: 10.1111/j.1365-313x.2012.04907.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008714 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0010154 fruit development Biological Process

GO:0035265 organ growth Biological Process

GO:0040009 regulation of growth rate Biological Process

GO:0046622 positive regulation of organ growth Biological Process

GO:0048316 seed development Biological Process

GO:0048437 floral organ development Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0048731 system development Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G13710

ath:AT2G46660

ath:AT3G61880

gmx:100799906

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.867

Rank 1 · TkA08G108180 · TK1151

Plastid0.063

Rank 2 · TkA08G108180 · TK1151

Golgi apparatus0.046

Rank 3 · TkA08G108180 · TK1151

Cytoplasm0.035

Rank 4 · TkA08G108180 · TK1151

Cell membrane0.032

Rank 5 · TkA08G108180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p45055-443 aa

PF27574EFCAB4A_helical287-353 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G108180	`PF00067`	p450	55	443	3e-69	234.7
TkA08G108180	`PF27574`	EFCAB4A_helical	287	353	0.013	16.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMX7`	Arabidopsis thaliana	sp\|Q9LMX7\|C78A5_ARATH Cytochrome P450 78A5	63.700%	Swiss-Prot	High
`Q9ZNR0`	Arabidopsis thaliana	sp\|Q9ZNR0\|C78A6_ARATH Cytochrome P450 78A6	51.600%	Swiss-Prot	High
`Q9SLP1`	Arabidopsis thaliana	sp\|Q9SLP1\|C78A9_ARATH Cytochrome P450 78A9	52.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card