TkA08G108120 | RubberDandelionOmics

Gene overview

TkA08G108120

Reference: TK1151 Chr: Chr08 Coordinates: 28113926-28114588 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

663 bp · TkA08G108120|TK1151|cDNA

ATGGCCACTGGTGAAACTGACCAGGGTTCAATAGTCGGACACGTAGCACGAAAGCCACGTGGCCGACCTGCGGGCTCCAAAAACAAGCCCAAACCACCCATCATCATCACTCGAGACAGTGCCAACACCCTCCGGGCTCATGCCATGGAAGTCATGTCTGGGTGTGATGTGGGTGAATGCCTAGCCACATTTGCTAGAAGAAAACAACGCGGTATCTGTGTTCTAAGTGCTACTGGTTGTGTTACCAATGTAAGTTTACG...

CDS

Download CDS FASTA

663 bp · TkA08G108120|TK1151|CDS

ATGGCCACTGGTGAAACTGACCAGGGTTCAATAGTCGGACACGTAGCACGAAAGCCACGTGGCCGACCTGCGGGCTCCAAAAACAAGCCCAAACCACCCATCATCATCACTCGAGACAGTGCCAACACCCTCCGGGCTCATGCCATGGAAGTCATGTCTGGGTGTGATGTGGGTGAATGCCTAGCCACATTTGCTAGAAGAAAACAACGCGGTATCTGTGTTCTAAGTGCTACTGGTTGTGTTACCAATGTAAGTTTACG...

Protein

Download Protein FASTA

220 aa · TkA08G108120|TK1151|PROTEIN

MATGETDQGSIVGHVARKPRGRPAGSKNKPKPPIIITRDSANTLRAHAMEVMSGCDVGECLATFARRKQRGICVLSATGCVTNVSLRQPNPSSGTGPIITLHGHFEILSLVGSILPPPSPPGVSGLEIYLAGQQGQVVGGAIIGPLIASGPVIIMAATFINATFDRLPIEKDESPPPDVNPLSHNQDMISVSDMYGIPQNLLSNAAEMYTWASARPLSKA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G108120`
TK1151 ID	TkA08G108120
OH-1004 ID	LXL04_010635
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	55.300
Protein coverage (%)	TK1151 91.364 / OH-1004 62.242 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G108120

Location Chr08:28113926-28114588 (-)

Description Similar to AHL18: AT-hook motif nuclear-localized protein 18

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g42940`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At2g45430`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	Over-expression of an AT-hook gene, AHL22, delays flowering and inhibits the elongation of the hypocotyl in Arabidopsis thaliana.2009 · DOI: 10.1007/s11103-009-9507-9 The AT-hook motif-containing protein AHL22 regulates flowering initiation by modifying FLOWERING LOCUS T chromatin in Arabidopsis.2012 · DOI: 10.1074/jbc.m111.318477
`At4g22810`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At4g12050`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At2g35270`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010635 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009647 skotomorphogenesis Biological Process

GO:0009908 flower development Biological Process

GO:0010208 pollen wall assembly Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0048364 root development Biological Process

GO:0141005 transposable element silencing by heterochromatin formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0003680 minor groove of adenine-thymine-rich DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT2G42940

ath:AT2G45430

ath:AT3G60870

ath:AT4G12050

ath:AT4G22810

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.877

Rank 1 · TkA08G108120 · TK1151

Cytoplasm0.190

Rank 2 · TkA08G108120 · TK1151

Cell membrane0.037

Rank 3 · TkA08G108120 · TK1151

Endoplasmic reticulum0.030

Rank 4 · TkA08G108120 · TK1151

Plastid0.018

Rank 5 · TkA08G108120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03479PCC39-159 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G108120	`PF03479`	PCC	39	159	2.8e-30	105.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJG4`	Arabidopsis thaliana	sp\|Q9SJG4\|AHL16_ARATH AT-hook motif nuclear-localized protein 16	60.300%	Swiss-Prot	High
`O22130`	Arabidopsis thaliana	sp\|O22130\|AHL22_ARATH AT-hook motif nuclear-localized protein 22	53.200%	Swiss-Prot	High
`O49662`	Arabidopsis thaliana	sp\|O49662\|AHL24_ARATH AT-hook motif nuclear-localized protein 24	52.700%	Swiss-Prot	High
`Q9SZ70`	Arabidopsis thaliana	sp\|Q9SZ70\|AHL26_ARATH AT-hook motif nuclear-localized protein 26	65.000%	Swiss-Prot	High
`O82166`	Arabidopsis thaliana	sp\|O82166\|AHL21_ARATH AT-hook motif nuclear-localized protein 21	66.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card