RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G108110
Reference: TK1151 Chr: Chr08 Coordinates: 28110127-28113272 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2123 bp · TkA08G108110|TK1151|cDNA

TTCCCGTTTTATCATTTCTCTCGATTAACAGTATATCTACCGAGAGGAAAAGAGAGAACAGCGTGAGTTTGGTCCTAGGGTTTTTTTGTTGATATAGTTTCCACTTCTGGGTTATTTGATACTACCGAGCAAGAAGAGATGGCGAAATCCGTTAGCCCAGATGCGATTTCGGTGATACTGTCGAACCCTACCCCAGATTCATCAACTGATCTTCCAGAAATTGTTGTACAAGTACTTGATATGAAGGCTGCTGGTAACAG...

CDS

Download CDS FASTA

1821 bp · TkA08G108110|TK1151|CDS

ATGGCGAAATCCGTTAGCCCAGATGCGATTTCGGTGATACTGTCGAACCCTACCCCAGATTCATCAACTGATCTTCCAGAAATTGTTGTACAAGTACTTGATATGAAGGCTGCTGGTAACAGATACACGTTTAATGTGAGTGATGGCAAGCTGAAGCTCAAGGCTATGTTACAATCTAGTTTGTCATCTGAAGTTACCAACGGAAATATCCAAAACCTGGGTCTTATCCGTATTAACGACTACACTCTCAACGACATCCC...

Protein

Download Protein FASTA

606 aa · TkA08G108110|TK1151|PROTEIN

MAKSVSPDAISVILSNPTPDSSTDLPEIVVQVLDMKAAGNRYTFNVSDGKLKLKAMLQSSLSSEVTNGNIQNLGLIRINDYTLNDIPNKNEKYLIVTKCEAVPPPLEAEFKVFPPSTEVKIEGSGIMMKPKQEVITKSAAQIVNEQNKNMAPSARMAMTRRVHPLASLNPYQGNWTIKVRVTAKGTMRTYKNAKGEGCVFNVELTDEDGTQIQATMFSEAARKFFDIFQMGKVYYISKGTLKVANKQYKTVENDYEMTLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G108110
TK1151 IDTkA08G108110
OH-1004 IDLXL04_031465
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G108110
LocationChr08:28110127-28113272 (+)
DescriptionSimilar to RPA1B: Replication protein A 70 kDa DNA-binding subunit B
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g08020 Component of the replication protein A complex (RPA) required for DNA recombination, repair and replication. No verified direct reference in this release
At5g61000 Component of the replication protein A complex (RPA) required for DNA recombination, repair and replication. No verified direct reference in this release
At2g06510 Component of the replication protein A complex (RPA) required for DNA recombination, repair and replication.
Replication protein A (AtRPA1a) is required for class I crossover formation but is dispensable for meiotic DNA break repair.2009 · DOI: 10.1038/emboj.2008.295
Arabidopsis replication protein A 70a is required for DNA damage response and telomere length homeostasis.2009 · DOI: 10.1093/pcp/pcp140

Rice

Reference gene IDPossible functionPapers / DOI
Os03g0214100 Component of the replication protein A complex (RPA) required for DNA recombination, repair and replication.
Two types of replication protein A in seed plants.2005 · DOI: 10.1111/j.1742-4658.2005.04719.x
Os02g0776800 Component of the replication protein A complex (RPA) required for DNA recombination, repair and replication.
Two types of replication protein A in seed plants.2005 · DOI: 10.1111/j.1742-4658.2005.04719.x
Replication protein A (RPA1a) is required for meiotic and somatic DNA repair but is dispensable for DNA replication and homologous recombination in rice.2009 · DOI: 10.1104/pp.109.142877
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031465 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000723 telomere maintenance Biological Process
GO:0000724 double-strand break repair via homologous recombination Biological Process
GO:0006260 DNA replication Biological Process
GO:0006281 DNA repair Biological Process
GO:0006289 nucleotide-excision repair Biological Process
GO:0006312 mitotic recombination Biological Process
GO:0007004 telomere maintenance via telomerase Biological Process
GO:0007131 reciprocal meiotic recombination Biological Process
GO:0007141 male meiosis I Biological Process
GO:0009555 pollen development Biological Process
GO:0010224 response to UV-B Biological Process
GO:0033260 nuclear DNA replication Biological Process
KEGG gene cross-reference
ath:AT2G06510
ath:AT5G08020
ath:AT5G61000
dosa:Os03g0214100
spo:2541158
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.935
Rank 1 · TkA08G108110 · TK1151
Cytoplasm0.201
Rank 2 · TkA08G108110 · TK1151
Mitochondrion0.028
Rank 3 · TkA08G108110 · TK1151
Cell membrane0.019
Rank 4 · TkA08G108110 · TK1151
Endoplasmic reticulum0.011
Rank 5 · TkA08G108110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04057Rep-A_N5-102 aa
PF01336tRNA_anti-codon28-59 aa
PF02721DUF223167-272 aa
PF01336tRNA_anti-codon176-262 aa
PF25507OB_POT1A179-229 aa
PF08646Rep_fac-A_C200-227 aa
PF16900REPA_OB_2201-225 aa
PF24833Rhabdo_glycop_CD230-262 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G108110PF04057Rep-A_N51029.4e-2484.1
TkA08G108110PF01336tRNA_anti-codon28592.2e-0937.8
TkA08G108110PF02721DUF2231672721.4e-1042.1
TkA08G108110PF01336tRNA_anti-codon1762622.2e-0937.8
TkA08G108110PF25507OB_POT1A1792290.2212.1
TkA08G108110PF08646Rep_fac-A_C2002275.2e-43147.0
TkA08G108110PF16900REPA_OB_22012252.4e-2485.8
TkA08G108110PF24833Rhabdo_glycop_CD2302620.02315.5
TkA08G108110PF16900REPA_OB_22923892.4e-2485.8
TkA08G108110PF28721DUF84482933450.003118.2
TkA08G108110PF08646Rep_fac-A_C4525975.2e-43147.0
TkA08G108110PF18892DUF56514724825.17.8
TkA08G108110PF18892DUF56514895085.17.8
TkA08G108110PF01336tRNA_anti-codon5105282.2e-0937.8
TkA08G108110PF25507OB_POT1A5195410.2212.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SD82Arabidopsis thalianasp|Q9SD82|RFA1B_ARATH Replication protein A 70 kDa DNA-binding subunit B68.400%Swiss-ProtHigh
Q9FME0Arabidopsis thalianasp|Q9FME0|RFA1D_ARATH Replication protein A 70 kDa DNA-binding subunit D66.900%Swiss-ProtHigh
Q9SKI4Arabidopsis thalianasp|Q9SKI4|RFA1A_ARATH Replication protein A 70 kDa DNA-binding subunit A31.800%Swiss-ProtMedium
Q10Q08Oryza sativa subsp. japonicasp|Q10Q08|RFA1B_ORYSJ Replication protein A 70 kDa DNA-binding subunit B62.700%Swiss-ProtHigh
Q6YZ49Oryza sativa subsp. japonicasp|Q6YZ49|RFA1A_ORYSJ Replication protein A 70 kDa DNA-binding subunit A30.100%Swiss-ProtMedium

JBrowse

View in Genome Browser