TkA08G107150 | RubberDandelionOmics

Gene overview

TkA08G107150

Reference: TK1151 Chr: Chr08 Coordinates: 27889739-27891223 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1131 bp · TkA08G107150|TK1151|cDNA

AAGAAAAATAAAATAAGATACTTGGTTTGAGGATGCTGAACTCATCATCTAAAACCCTTCTTAAAACCTTTTACGGCAATTGAACATCACCGGCGACCAACGCCGCACAAAAACACAATTCAGGGCGAACTTCCATTCCGACGCACACAGCAATGTTATTCCGGCTGGTCGGTCGCATGGGAAGAAGACCAACATCCCTCTTCTCTCAACACTCTTATCGTCACATAACCCTAATTGAACATCCTTTTGCTCATCGATCT...

CDS

Download CDS FASTA

750 bp · TkA08G107150|TK1151|CDS

ATGTTATTCCGGCTGGTCGGTCGCATGGGAAGAAGACCAACATCCCTCTTCTCTCAACACTCTTATCGTCACATAACCCTAATTGAACATCCTTTTGCTCATCGATCTTCAATCGAAAACAACTATGTCGACTACGTCCCTCAACAATCGAAAAGGTACGTATCATTGATGCGGAAATTAGCTTTTGAAGACGGCATACGTAGACTCATCCGCAACGATATCCAATACGAACTCGATCGATCTCCTCGTACTCAGCTTGT...

Protein

Download Protein FASTA

249 aa · TkA08G107150|TK1151|PROTEIN

MLFRLVGRMGRRPTSLFSQHSYRHITLIEHPFAHRSSIENNYVDYVPQQSKRYVSLMRKLAFEDGIRRLIRNDIQYELDRSPRTQLVPKFKSFAIDERPGEQWIRLNTKFGDDEDIKVEVTMFRVSTPPTKEGSITTQNDLELYISMVIDIVKGEENGILQFLCNIWPESVEIEKVFMRNQDGMAGKPYLGPPFNDLDDELQTSLYDFLETRGINDELAVFLHKCMQHKSKNEYIRWMETLESYVARKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G107150`
TK1151 ID	TkA08G107150
OH-1004 ID	LXL04_031447
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G107150`
Location	Chr08:27889739-27891223 (-)
Description	Similar to At2g39795: Uncharacterized protein At2g39795, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031447` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009060 aerobic respiration Biological Process GO:0042256 cytosolic ribosome assembly Biological Process GO:1902775 mitochondrial large ribosomal subunit assembly Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0097177 mitochondrial ribosome binding Molecular Function
KEGG gene cross-reference	ath:AT2G39790 ath:AT2G39795 sce:YIL070C spo:2541189 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.857

Rank 1 · TkA08G107150 · TK1151

Nucleus0.075

Rank 2 · TkA08G107150 · TK1151

Plastid0.069

Rank 3 · TkA08G107150 · TK1151

Cytoplasm0.062

Rank 4 · TkA08G107150 · TK1151

Cell membrane0.014

Rank 5 · TkA08G107150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02330MAM3374-245 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G107150	`PF02330`	MAM33	74	245	2.3e-31	110.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card