TkA08G106910 | RubberDandelionOmics

Gene overview

TkA08G106910

Reference: TK1151 Chr: Chr08 Coordinates: 27829883-27832184 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2104 bp · TkA08G106910|TK1151|cDNA

ATGGAGCAGGATTTGCCGCCGTTGCCGGAAATGTACCAGGGTGTTGGGTCTGATTCTGTAATGATTCCGTTTCATGAGGGGAATAGTTGCGTACAGGTGACGAAGGAGAATGGTAATGGAGGTGGGAGGTTATCGGCGCAGAGTATGGCGGCGAGGGTGAGGAGGAGGAAGATAAGCGAGAAGACATTAGAGCTTGGGAAGCTGGTACCTGGTGGTCATCGGATGAACACGGCGGAGATGTTTCAGGCGGCATTTAAGTA...

CDS

Download CDS FASTA

462 bp · TkA08G106910|TK1151|CDS

ATGGAGCAGGATTTGCCGCCGTTGCCGGAAATGTACCAGGGTGTTGGGTCTGATTCTGTAATGATTCCGTTTCATGAGGGGAATAGTTGCGTACAGGTGACGAAGGAGAATGGTAATGGAGGTGGGAGGTTATCGGCGCAGAGTATGGCGGCGAGGGTGAGGAGGAGGAAGATAAGCGAGAAGACATTAGAGCTTGGGAAGCTGGTACCTGGTGGTCATCGGATGAACACGGCGGAGATGTTTCAGGCGGCATTTAAGTA...

Protein

Download Protein FASTA

153 aa · TkA08G106910|TK1151|PROTEIN

MEQDLPPLPEMYQGVGSDSVMIPFHEGNSCVQVTKENGNGGGRLSAQSMAARVRRRKISEKTLELGKLVPGGHRMNTAEMFQAAFKYVKFLQAQVGLLQLMVIHREPSEELHDLVTSPSIQEKLYHAEKCIVTRTLGELLAINPSRNQEHTTS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G106910`
TK1151 ID	TkA08G106910
OH-1004 ID	LXL04_031438
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.100
Protein coverage (%)	TK1151 100.000 / OH-1004 56.226 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G106910

Location Chr08:27829883-27832184 (+)

Description Similar to BHLH52: Transcription factor bHLH52

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g34820`	Transcription factor bHLH53.	No verified direct reference in this release
`At1g30670`	Transcription factor bHLH52.	No verified direct reference in this release
`At5g09750`	Required for the female reproductive tract development and fertility.	The HECATE genes regulate female reproductive tract development in Arabidopsis thaliana.2007 · DOI: 10.1242/dev.011510
`At5g67060`	Required for the female reproductive tract development and fertility.	The HECATE genes regulate female reproductive tract development in Arabidopsis thaliana.2007 · DOI: 10.1242/dev.011510

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0831000`	Transcription factor that seems to regulate organogenesis in postembryonic development.	LAX PANICLE2 of rice encodes a novel nuclear protein and regulates the formation of axillary meristems.2011 · DOI: 10.1105/tpc.111.088765

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031438 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009555 pollen development Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0022619 generative cell differentiation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0055046 microgametogenesis Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G30670

ath:AT2G34820

ath:AT3G21330

ath:AT4G00120

dosa:Os01g0831000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.950

Rank 1 · TkA08G106910 · TK1151

Cytoplasm0.164

Rank 2 · TkA08G106910 · TK1151

Cell membrane0.023

Rank 3 · TkA08G106910 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA08G106910 · TK1151

Mitochondrion0.011

Rank 5 · TkA08G106910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21226MalQ_N19-77 aa

PF00010HLH47-92 aa

PF23173bHLH_SAC5153-94 aa

PF00010HLH109-124 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G106910	`PF21226`	MalQ_N	19	77	0.092	14.1
TkA08G106910	`PF00010`	HLH	47	92	0.00032	21.1
TkA08G106910	`PF23173`	bHLH_SAC51	53	94	0.0044	17.6
TkA08G106910	`PF00010`	HLH	109	124	0.00032	21.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84RD0`	Arabidopsis thaliana	sp\|Q84RD0\|BH053_ARATH Transcription factor bHLH53	61.300%	Swiss-Prot	Medium
`Q9SA82`	Arabidopsis thaliana	sp\|Q9SA82\|BH052_ARATH Transcription factor bHLH52	53.400%	Swiss-Prot	Medium
`Q9LXD8`	Arabidopsis thaliana	sp\|Q9LXD8\|HEC3_ARATH Transcription factor HEC3	55.800%	Swiss-Prot	Low
`Q9FHA7`	Arabidopsis thaliana	sp\|Q9FHA7\|HEC1_ARATH Transcription factor HEC1	44.600%	Swiss-Prot	Medium
`Q7XAQ6`	Oryza sativa subsp. japonica	sp\|Q7XAQ6\|LAX1_ORYSJ Transcription factor LAX PANICLE 1	48.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card