Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1373 bp · TkA08G105960|TK1151|cDNA
CACCGCCACCACATCCCTCTATTTCTCATATATGATATATCTCAACATATGTCTATATATAGCACTGTTGGTACAATGTTTATCCTACTTCTAATATAAGACTCTTCTCTTGCCGTTTCTTTCAAGTTCTAATAAGAACACATACACCTACTGTGTATAAAAATATACAGAATCAGTACATAAATCCTTCAAAAAGAGAGCTTGAAGAAGGCGAAAATGGGAAGACCACCATGCTGTGATAGCATCGGAGTGAAGAAAGG...
456 bp · TkA08G105960|TK1151|CDS
ATGGCCAAACAGGCCCTTTCAGACGCCCTATCACTCAACAACAAATCCACCGCTACATGGCAGCCGCCGCCATGCACAACCGCTATTCCACCAATCGACCAAAAACCGGAGTTACTACCTCCACCTCCGGGGAAATTCGTAACCTCCTCCAATTACGCATTGAGTTCCGATAACATTGCGAGGTTGCTTCCAAACTGGTTTGAGAAAAAGTCTTCACAAACAAGCTCTCATGAAAGCATCGGTAATTTCAATCAGCAGTT...
Protein
Download Protein FASTA151 aa · TkA08G105960|TK1151|PROTEIN
MAKQALSDALSLNNKSTATWQPPPCTTAIPPIDQKPELLPPPPGKFVTSSNYALSSDNIARLLPNWFEKKSSQTSSHESIGNFNQQFPSPPTSEGFKNYSNSEVSETTSLFHGESKPINIMEYQLPSLSFLEKCCLMMLLLKDMKGLWICH
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G105960 |
|---|---|
| TK1151 ID | TkA08G105960 |
| OH-1004 ID | LXL04_031426 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 98.500 |
| Protein coverage (%) | TK1151 88.742 / OH-1004 42.006Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G105960 |
|---|---|
| Location | Chr08:27605886-27607437 (+) |
| Description | Similar to MYB306: Myb-related protein 306 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0001666 response to hypoxia Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006952 defense response Biological Process GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009617 response to bacterium Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0009644 response to high light intensity Biological Process GO:0009651 response to salt stress Biological Process GO:0009733 response to auxin Biological Process GO:0009737 response to abscisic acid Biological Process |
| KEGG gene cross-reference | ath:AT3G28910 ath:AT3G47600 ath:AT5G62470 vvi:100233072 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.