TkA08G105030 | RubberDandelionOmics

Gene overview

TkA08G105030

Reference: TK1151 Chr: Chr08 Coordinates: 27269785-27272837 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1314 bp · TkA08G105030|TK1151|cDNA

AAAAATCTTGCCATAATTTTTGCCATCGGATTTGGGGTGTATTTGGGCGGGAAAAGTGAACTGAAGATAAATATGATGGCGATACGTGTCCTGGTCAGTTGCATTGTTTTGGCTTTCGTCCATCTGCGTCGTCTTTCTATACTATAGTCTATAAACCCTGCCCCTAAGAAACCCTAATTGCCGAGTCTACAAATGAACATGGCGGCACCAAATGGACAGAACGATTTGACGATGAAGGAGCTTGACATACAGATGATGTT...

CDS

Download CDS FASTA

912 bp · TkA08G105030|TK1151|CDS

ATGAACATGGCGGCACCAAATGGACAGAACGATTTGACGATGAAGGAGCTTGACATACAGATGATGTTGTCTGCTGAAGTTCATCTCGGTACTAAGAACTGTGATTTTCAGATGGAACGCTACGTCTTCAAGCGCCGCAACGACGGAATCTACATCATCAATCTCGGGAAAACATGGGAGAAGCTTCAAATGGCAGCCAGAGTTATCGTTGCCATAGAGAATCCCCAGGATATCATTGTTCAATCCGCCAGACCATATGG...

Protein

Download Protein FASTA

303 aa · TkA08G105030|TK1151|PROTEIN

MNMAAPNGQNDLTMKELDIQMMLSAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQLQTSFSEPRLLILTDPRTDHQPIKEAALGNIPTIAFCDTDSPMRYVDVGIPANNKGKHSIGCLFWILARMVLQMRGVINQGHKWDVMVDLFFYREPEETKEPEDEAALVTDYPDYGGGGALGGMGDQWSSQIPDAQWAPDMPPPI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G105030`
TK1151 ID	TkA08G105030
OH-1004 ID	LXL04_031403
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.340 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G105030

Location Chr08:27269785-27272837 (+)

Description Similar to 179B: 40S ribosomal protein SA

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72370`	Required for the assembly and/or stability of the 40S ribosomal subunit.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031403 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000028 ribosomal small subunit assembly Biological Process

GO:0002181 cytoplasmic translation Biological Process

GO:0006412 translation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0022627 cytosolic small ribosomal subunit Cellular Component

GO:0003735 structural constituent of ribosome Molecular Function

KEGG gene cross-reference

ath:AT3G04770

bna:106354211

cam:101509570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.737

Rank 1 · TkA08G105030 · TK1151

Nucleus0.360

Rank 2 · TkA08G105030 · TK1151

Endoplasmic reticulum0.091

Rank 3 · TkA08G105030 · TK1151

Cell membrane0.074

Rank 4 · TkA08G105030 · TK1151

Mitochondrion0.066

Rank 5 · TkA08G105030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00318Ribosomal_S222-116 aa

PF00318Ribosomal_S2121-186 aa

PF1612240S_SA_C206-274 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G105030	`PF00318`	Ribosomal_S2	22	116	3.6e-26	92.5
TkA08G105030	`PF00318`	Ribosomal_S2	121	186	3.6e-26	92.5
TkA08G105030	`PF16122`	40S_SA_C	206	274	0.82	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q08682`	Arabidopsis thaliana	sp\|Q08682\|RSSA1_ARATH Small ribosomal subunit protein uS2z	73.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card