TkA08G104750 | RubberDandelionOmics

Gene overview

TkA08G104750

Reference: TK1151 Chr: Chr08 Coordinates: 27191263-27194214 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2081 bp · TkA08G104750|TK1151|cDNA

AACAGAAGCAGTAAGCTAAAGCACCATCGTCCTTCGTGTTCGTGATACTGAATTACTGATACGCAGCGAGTACGCCTCCTTCTTCCCCCTTCAGACTCACTCAGTCGCCAGACCAGTACCGCCGGTCCCCGGAAACATGGAAGATATCGAGGATTTGTTGGTAGGCGCCGGCGCTGCTCCAGCCGGTTTCCGACTCCCCATTACCGCCGCCGTCGGAATAAATCCAATAAAAAAGAAGAAAAACAATAAACTAGAGCCAT...

CDS

Download CDS FASTA

1821 bp · TkA08G104750|TK1151|CDS

ATGGAAGATATCGAGGATTTGTTGGTAGGCGCCGGCGCTGCTCCAGCCGGTTTCCGACTCCCCATTACCGCCGCCGTCGGAATAAATCCAATAAAAAAGAAGAAAAACAATAAACTAGAGCCATTATCCTTGCTTCAAAACTCCTCCACTCCTCAAGTCCCTGGAACTCAGACGATTTTTTTGAAGACATTCGGGTGCTCACACAACCAGAGTGACAGTGAGTACATGGCCGGCCAACTTTCCTCATTTGGCTATGCCAT...

Protein

Download Protein FASTA

606 aa · TkA08G104750|TK1151|PROTEIN

MEDIEDLLVGAGAAPAGFRLPITAAVGINPIKKKKNNKLEPLSLLQNSSTPQVPGTQTIFLKTFGCSHNQSDSEYMAGQLSSFGYAISDNAEGADLWLINTCTVKSPSQSAMDTLISKCKTAKKPLVVAGCVPQGSRDLKELEGVSIVGVQQIDRVVEVVEETLKGHEVRLLNRKTLPSLDLPKVRKNKFVEILPINVGCLGACTYCKTKHARGHLGSYTVDSLVGRVKSVVDDGVKEIWISSEDTGAYGRDIGVNLPIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G104750`
TK1151 ID	TkA08G104750
OH-1004 ID	LXL04_031396
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G104750`
Location	Chr08:27191263-27194214 (-)
Description	Similar to cdkal1: Threonylcarbamoyladenosine tRNA methylthiotransferase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031396` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0035600 tRNA methylthiolation Biological Process GO:1990145 maintenance of translational fidelity Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005791 rough endoplasmic reticulum Cellular Component GO:0012505 endomembrane system Cellular Component GO:0016020 membrane Cellular Component GO:0035598 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase activity Molecular Function GO:0046872 metal ion binding Molecular Function GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function
KEGG gene cross-reference	dme:Dmel_CG6550 hsa:54901 mmu:68916 xla:432014 xtr:394802 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.529

Rank 1 · TkA08G104750 · TK1151

Cytoplasm0.193

Rank 2 · TkA08G104750 · TK1151

Nucleus0.126

Rank 3 · TkA08G104750 · TK1151

Mitochondrion0.090

Rank 4 · TkA08G104750 · TK1151

Endoplasmic reticulum0.078

Rank 5 · TkA08G104750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00919UPF000459-137 aa

PF20045DUF6447147-165 aa

PF04055Radical_SAM196-369 aa

PF20045DUF6447312-348 aa

PF04055Radical_SAM372-446 aa

PF01938TRAM421-480 aa

PF20045DUF6447464-483 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G104750	`PF00919`	UPF0004	59	137	7.5e-21	74.7
TkA08G104750	`PF20045`	DUF6447	147	165	0.29	11.6
TkA08G104750	`PF04055`	Radical_SAM	196	369	7e-21	75.8
TkA08G104750	`PF20045`	DUF6447	312	348	0.29	11.6
TkA08G104750	`PF04055`	Radical_SAM	372	446	7e-21	75.8
TkA08G104750	`PF01938`	TRAM	421	480	1.3e-05	25.7
TkA08G104750	`PF20045`	DUF6447	464	483	0.29	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card