RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G104280
Reference: TK1151 Chr: Chr08 Coordinates: 27069685-27072024 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1334 bp · TkA08G104280|TK1151|cDNA

CACATCTCCGTGCCTTGACATACGCAGTTTACCCCACCCCTCACACTTTAAGACTCTAACCAACCCTTATACAATCCCACCCTGAACTTCATCTCCCCACTTCTCCCTTCCCCCCAAATAACAAACAGATCCCTAAATATTATTCCAATCCTCCATTTTCACTCACAACATTTATACTCCACCATTCACCTTCAACCAATTAAAATGTCGCAAAACACACACCAAGCGACGCGACTTATCAGCTCCTAACCCACAACCAC...

CDS

Download CDS FASTA

360 bp · TkA08G104280|TK1151|CDS

ATGAAGAACAGGAAGACAACATTAGAGAGCGATTGTAGTCAGCAACAAATCCCCACCAAAAAATCAGAAGATTACGTTAATTTGAAGTCACCGAATCCAGACAAAAATGGAGACGAGGTGAAGGAATTACAACAAGGGTATGATATCGCGAAGCAATCGTTATCATCAATAGGCAGGAGTAAGGGCAGAAGGAGGTCATTTGGGAGCAGCTCGCAAGCTGAGCTGGCCGATTTCTTGCGTGTAATGGCGTCAAAGTGGTT...

Protein

Download Protein FASTA

119 aa · TkA08G104280|TK1151|PROTEIN

MKNRKTTLESDCSQQQIPTKKSEDYVNLKSPNPDKNGDEVKELQQGYDIAKQSLSSIGRSKGRRRSFGSSSQAELADFLRVMASKWFLLTCRPICKSMLLMLPEKRMIAWKSSLPKLLL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G104280
TK1151 IDTkA08G104280
OH-1004 IDLXL04_031383
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)100.000
Protein coverage (%)TK1151 52.101 / OH-1004 21.017
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G104280
LocationChr08:27069685-27072024 (+)
DescriptionSimilar to dlcB: Dynein light chain, cytoplasmic
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031383 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000132 establishment of mitotic spindle orientation Biological Process
GO:0007017 microtubule-based process Biological Process
GO:0007283 spermatogenesis Biological Process
GO:0007290 spermatid nucleus elongation Biological Process
GO:0007291 sperm individualization Biological Process
GO:0030473 nuclear migration along microtubule Biological Process
GO:0031507 heterochromatin formation Biological Process
GO:0034454 microtubule anchoring at centrosome Biological Process
GO:0035721 intraciliary retrograde transport Biological Process
GO:0044458 motile cilium assembly Biological Process
GO:0051017 actin filament bundle assembly Biological Process
GO:0051301 cell division Biological Process
KEGG gene cross-reference
cel:CELE_T26A5.9
ddi:DDB_G0274815
dme:Dmel_CG5450
dme:Dmel_CG6998
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.500
Rank 1 · TkA08G104280 · TK1151
Cytoplasm0.352
Rank 2 · TkA08G104280 · TK1151
Cell membrane0.129
Rank 3 · TkA08G104280 · TK1151
Mitochondrion0.095
Rank 4 · TkA08G104280 · TK1151
Endoplasmic reticulum0.084
Rank 5 · TkA08G104280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser