TkA08G102870 | RubberDandelionOmics

Gene overview

TkA08G102870

Reference: TK1151 Chr: Chr08 Coordinates: 26666713-26668883 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1778 bp · TkA08G102870|TK1151|cDNA

CCATGATCCCCATCTCTCCCCCATCAAACGATCTCTTAAATAATTTGCAAACAAGAAGAAGAAACTCATCAAGATCCATGAAGAAACCAACCACCAACGTCCACCCACACGAAACCCCAAACCTAAGAGACCATTACACAATCGGAAACAAGCTTGGCCAAGGCCAATTCGGCACCACCTATCTCTGCACTGACAAATCCACGGGAACCGATTACGCTTGTAAATCCATCCCCAAAAGGAAACTCTTATGCAAAGACGAT...

CDS

Download CDS FASTA

774 bp · TkA08G102870|TK1151|CDS

ATGATCCCCATCTCTCCCCCATCAAACGATCTCTTAAATAATTTGCAAACAAGAAGAAGAAACTCATCAAGATCCATGAAGAAACCAACCACCAACGTCCACCCACACGAAACCCCAAACCTAAGAGACCATTACACAATCGGAAACAAGCTTGGCCAAGGCCAATTCGGCACCACCTATCTCTGCACTGACAAATCCACGGGAACCGATTACGCTTGTAAATCCATCCCCAAAAGGAAACTCTTATGCAAAGACGATTA...

Protein

Download Protein FASTA

257 aa · TkA08G102870|TK1151|PROTEIN

MIPISPPSNDLLNNLQTRRRNSSRSMKKPTTNVHPHETPNLRDHYTIGNKLGQGQFGTTYLCTDKSTGTDYACKSIPKRKLLCKDDYDDVWREIQIMHHLSENPCVVRIKGTYEDNVFVHLVMELCTGGELLDRIVDKGWCSERQAAKFIKTVVDVVVACHSMGVMHRDLKPENFLFDSREKNAQLKAIDFGLSIFYKPGEYLCDVVGSPYYVAPEVLHKHYGPEIDVWSAGVILYIYYVGSHLFGQRRIQASLKRF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G102870`
TK1151 ID	TkA08G102870
OH-1004 ID	LXL04_031356
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.700
Protein coverage (%)	TK1151 84.047 / OH-1004 44.720 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G102870

Location Chr08:26666713-26668883 (-)

Description Similar to CPK11: Calcium-dependent protein kinase 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g09570`	May play a role in signal transduction pathways that involve calcium as a second messenger.	A novel yeast two-hybrid approach to identify CDPK substrates: characterization of the interaction between AtCPK11 and AtDi19, a nuclear zinc finger protein.2006 · DOI: 10.1016/j.febslet.2006.01.013 Two calcium-dependent protein kinases, CPK4 and CPK11, regulate abscisic acid signal transduction in Arabidopsis.2007 · DOI: 10.1105/tpc.107.050666
`At1g35670`	May play a role in signal transduction pathways that involve calcium as a second messenger.	Two calcium-dependent protein kinases, CPK4 and CPK11, regulate abscisic acid signal transduction in Arabidopsis.2007 · DOI: 10.1105/tpc.107.050666 Two genes that encode Ca(2+)-dependent protein kinases are induced by drought and high-salt stresses in Arabidopsis thaliana.1994 · DOI: 10.1007/bf00286684

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0171500`	May play a role in signal transduction pathways that involve calcium as a second messenger (By similarity).	No verified direct reference in this release
`Os12g0169800`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031356 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004683 calcium/calmodulin-dependent protein kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G35670

ath:AT4G09570

dosa:Os11g0171500

dosa:Os12g0169800

gmx:547825

osa:4349899

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.609

Rank 1 · TkA08G102870 · TK1151

Nucleus0.459

Rank 2 · TkA08G102870 · TK1151

Mitochondrion0.076

Rank 3 · TkA08G102870 · TK1151

Cell membrane0.059

Rank 4 · TkA08G102870 · TK1151

Endoplasmic reticulum0.045

Rank 5 · TkA08G102870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase45-250 aa

PF07714PK_Tyr_Ser-Thr46-236 aa

PF14531Kinase-like48-88 aa

PF01636APH53-162 aa

PF01163RIO192-180 aa

PF06293Kdo121-191 aa

PF03109ABC1121-199 aa

PF14531Kinase-like142-180 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G102870	`PF00069`	Pkinase	45	250	3.2e-60	204.5
TkA08G102870	`PF07714`	PK_Tyr_Ser-Thr	46	236	2.6e-21	76.8
TkA08G102870	`PF14531`	Kinase-like	48	88	0.13	12.3
TkA08G102870	`PF01636`	APH	53	162	0.00022	21.8
TkA08G102870	`PF01163`	RIO1	92	180	0.27	11.6
TkA08G102870	`PF06293`	Kdo	121	191	4.7e-05	23.6
TkA08G102870	`PF03109`	ABC1	121	199	0.00056	19.9
TkA08G102870	`PF14531`	Kinase-like	142	180	0.13	12.3
TkA08G102870	`PF01636`	APH	164	193	0.00022	21.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38869`	Arabidopsis thaliana	sp\|Q38869\|CDPK4_ARATH Calcium-dependent protein kinase 4	77.300%	Swiss-Prot	High
`Q39016`	Arabidopsis thaliana	sp\|Q39016\|CDPKB_ARATH Calcium-dependent protein kinase 11	76.800%	Swiss-Prot	High
`Q53P85`	Oryza sativa subsp. japonica	sp\|Q53P85\|CDPKO_ORYSJ Calcium-dependent protein kinase 24	73.700%	Swiss-Prot	High
`Q2QX45`	Oryza sativa subsp. japonica	sp\|Q2QX45\|CDPKS_ORYSJ Calcium-dependent protein kinase 28	71.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card