TkA08G101930 | RubberDandelionOmics

Gene overview

TkA08G101930

Reference: TK1151 Chr: Chr08 Coordinates: 26438801-26444514 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4402 bp · TkA08G101930|TK1151|cDNA

ATGTTTATTGCAGGAAGTACCGACCACAGAGGCACCCCCGAATATCCGGGAAGAACTGTCACTTTGGAACCTGCAGAAGGGGAAGTTTGCTGGGGTGTCGCCTATAAAATATCAAGGAAGGAAGATCAAGAAGTGGCATTAACGTATCTAGAGGTGAGGGAGAAACAATATGACAAGAAGGCATATGTTGACTTCTTCACAGAACCGTCAGCTTCATCACCCGCTATTACCGGAGTAATGTTATATATAGCTTCTCCGGA...

CDS

Download CDS FASTA

474 bp · TkA08G101930|TK1151|CDS

ATGTTTATTGCAGGAAGTACCGACCACAGAGGCACCCCCGAATATCCGGGAAGAACTGTCACTTTGGAACCTGCAGAAGGGGAAGTTTGCTGGGGTGTCGCCTATAAAATATCAAGGAAGGAAGATCAAGAAGTGGCATTAACGTATCTAGAGGTGAGGGAGAAACAATATGACAAGAAGGCATATGTTGACTTCTTCACAGAACCGTCAGCTTCATCACCCGCTATTACCGGAGTAATGTTATATATAGCTTCTCCGGA...

Protein

Download Protein FASTA

157 aa · TkA08G101930|TK1151|PROTEIN

MFIAGSTDHRGTPEYPGRTVTLEPAEGEVCWGVAYKISRKEDQEVALTYLEVREKQYDKKAYVDFFTEPSASSPAITGVMLYIASPDKANKNYLGPATVEEIAKQIVNAEGPSGPNRDYLFNLEKTLLEMGCKDEHVIKIADHARKLISGVENGKLD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G101930`
TK1151 ID	TkA08G101930
OH-1004 ID	LXL04_031335
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 73.709 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G101930

Location Chr08:26438801-26444514 (+)

Description Similar to GGCT2;3: Gamma-glutamylcyclotransferase 2-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g44790`	Converts GSH to 5-oxoproline and cysteine-glycine (Cys-Gly) dipeptide in vitro and plays a significant role in glutathione (GSH) homeostasis.	Defining the cytosolic pathway of glutathione degradation in Arabidopsis thaliana: role of the ChaC/GCG family of γ-glutamyl cyclotransferases as glutathione-degrading enzymes and AtLAP1 as the Cys-Gly peptidase.2015 · DOI: 10.1042/bj20141154
`At5g26220`	Catalyzes the formation of 5-oxoproline from gamma-glutamyl dipeptides and plays a significant role in glutathione (GSH) homeostasis.	A γ-glutamyl cyclotransferase protects Arabidopsis plants from heavy metal toxicity by recycling glutamate to maintain glutathione homeostasis.2013 · DOI: 10.1105/tpc.113.111815
`At4g31290`	Converts GSH to 5-oxoproline and cysteine-glycine (Cys-Gly) dipeptide in vitro and plays a significant role in glutathione (GSH) homeostasis.	Defining the cytosolic pathway of glutathione degradation in Arabidopsis thaliana: role of the ChaC/GCG family of γ-glutamyl cyclotransferases as glutathione-degrading enzymes and AtLAP1 as the Cys-Gly peptidase.2015 · DOI: 10.1042/bj20141154

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031335 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006751 glutathione catabolic process Biological Process

GO:0010288 response to lead ion Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003839 gamma-glutamylcyclotransferase activity Molecular Function

GO:0061928 glutathione specific gamma-glutamylcyclotransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G44790

ath:AT4G31290

ath:AT5G26220

mmu:68044

rno:360994

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.718

Rank 1 · TkA08G101930 · TK1151

Nucleus0.320

Rank 2 · TkA08G101930 · TK1151

Mitochondrion0.121

Rank 3 · TkA08G101930 · TK1151

Cell membrane0.079

Rank 4 · TkA08G101930 · TK1151

Endoplasmic reticulum0.054

Rank 5 · TkA08G101930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04752ChaC2-146 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G101930	`PF04752`	ChaC	2	146	9.9e-37	127.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84QC1`	Arabidopsis thaliana	sp\|Q84QC1\|GCT23_ARATH Gamma-glutamylcyclotransferase 2-3	63.900%	Swiss-Prot	High
`Q8GY54`	Arabidopsis thaliana	sp\|Q8GY54\|GCT21_ARATH Gamma-glutamylcyclotransferase 2-1	47.100%	Swiss-Prot	Medium
`Q84MC1`	Arabidopsis thaliana	sp\|Q84MC1\|GCT22_ARATH Gamma-glutamylcyclotransferase 2-2	47.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card