TkA08G101340 | RubberDandelionOmics

Gene overview

TkA08G101340

Reference: TK1151 Chr: Chr08 Coordinates: 26294986-26301011 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2805 bp · TkA08G101340|TK1151|cDNA

ATGAGAGCGAGGTTGAAGAATCATCGACTTGCTCGCATCTGCATCCATCGCCTGTTTCTCCAGATCGTGAAGAACCCCTTCGTGTTAGGGTTTCGTTCGTGCTTCGCGAACCGATCAACTAGGGTTTCTCTTCTCGAAGGAAGAACCCCTCTCCGCTCCGATCTGTCTCCTGCAATCCACAATCGACTTCCTGGTAGTGGTGTTTCCCCAAAACCTGGGAACACCATTGATCCTGATGACCCATTATATGTCCACCTCTC...

CDS

Download CDS FASTA

2805 bp · TkA08G101340|TK1151|CDS

ATGAGAGCGAGGTTGAAGAATCATCGACTTGCTCGCATCTGCATCCATCGCCTGTTTCTCCAGATCGTGAAGAACCCCTTCGTGTTAGGGTTTCGTTCGTGCTTCGCGAACCGATCAACTAGGGTTTCTCTTCTCGAAGGAAGAACCCCTCTCCGCTCCGATCTGTCTCCTGCAATCCACAATCGACTTCCTGGTAGTGGTGTTTCCCCAAAACCTGGGAACACCATTGATCCTGATGACCCATTATATGTCCACCTCTC...

Protein

Download Protein FASTA

934 aa · TkA08G101340|TK1151|PROTEIN

MRARLKNHRLARICIHRLFLQIVKNPFVLGFRSCFANRSTRVSLLEGRTPLRSDLSPAIHNRLPGSGVSPKPGNTIDPDDPLYVHLSDNNVTNIIGFKLLGNENYRIWRSSMIRALKCRNKLGFTDGSLKKPTGDNIKELKWERANAVTCSWLLGSISDVIYAGHACSESAQEIWEDLFETYNKADGSIIFNLHQKINSLTQGGLSLSDYFNKLESYWKEFDGLINITDCTCNASTSLKDHSKLMKLMQFLSGLDDSYSQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G101340`
TK1151 ID	TkA08G101340
OH-1004 ID	LXL04_016743
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	31.300
Protein coverage (%)	TK1151 91.113 / OH-1004 94.298 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G101340

Location Chr08:26294986-26301011 (+)

Description Similar to RE1: Retrovirus-related Pol polyprotein from transposon RE1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q94HW2`	Retrovirus-related Pol polyprotein from transposon RE1.	No verified direct reference in this release
`At4g02960`	Retrovirus-related Pol polyprotein from transposon RE2.	No verified direct reference in this release
`UniProt: P92519`	Uncharacterized mitochondrial protein AtMg00810.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016743 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006508 proteolysis Biological Process

GO:0015074 DNA integration Biological Process

GO:0003676 nucleic acid binding Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.604

Rank 1 · TkA08G101340 · TK1151

Nucleus0.410

Rank 2 · TkA08G101340 · TK1151

Mitochondrion0.067

Rank 3 · TkA08G101340 · TK1151

Peroxisome0.034

Rank 4 · TkA08G101340 · TK1151

Endoplasmic reticulum0.034

Rank 5 · TkA08G101340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14244Retrotran_gag_385-133 aa

PF14223Retrotran_gag_2117-217 aa

PF20292MC7187-230 aa

PF22936Pol_BBD345-420 aa

PF07727RVT_2619-683 aa

PF14223Retrotran_gag_2698-718 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G101340	`PF14244`	Retrotran_gag_3	85	133	4.4e-12	46.3
TkA08G101340	`PF14223`	Retrotran_gag_2	117	217	0.0057	17.2
TkA08G101340	`PF20292`	MC7	187	230	0.015	16.0
TkA08G101340	`PF22936`	Pol_BBD	345	420	1.3e-08	35.8
TkA08G101340	`PF07727`	RVT_2	619	683	2.4e-10	41.1
TkA08G101340	`PF14223`	Retrotran_gag_2	698	718	0.0057	17.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94HW2`	Arabidopsis thaliana	sp\|Q94HW2\|POLR1_ARATH Retrovirus-related Pol polyprotein from transposon RE1	40.300%	Swiss-Prot	Low
`Q9ZT94`	Arabidopsis thaliana	sp\|Q9ZT94\|POLR2_ARATH Retrovirus-related Pol polyprotein from transposon RE2	38.300%	Swiss-Prot	Low
`P92519`	Arabidopsis thaliana	sp\|P92519\|M810_ARATH Uncharacterized mitochondrial protein AtMg00810	41.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card