TkA08G101320 | RubberDandelionOmics

Gene overview

TkA08G101320

Reference: TK1151 Chr: Chr08 Coordinates: 26285016-26291059 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3941 bp · TkA08G101320|TK1151|cDNA

TGATAGCACATTAAAATTCCATACATCATGCGATTGAGAGAAGAAGCAGATTTGACTTCCTTTGATGAGAGAGAATAGAAAGGTAAAGAATAGAATGAGGAAAATTCAATCGGATACAATTCTACTTTGACGTCCGCTAGGAGAACAACACACTCTCTCTCTACTTTCTCTCTCTAAACTTACAGCGAAGAACAGGAATTTCCTCTCATCTCTCCATAAAGAGAAAGATTGAAGACAACCTGTCACTGAAGAAGCTTCAA...

CDS

Download CDS FASTA

2595 bp · TkA08G101320|TK1151|CDS

ATGGTACCTCCAGGGCCACCCACTCCACTTGCTGGTTCGCAATCTGTTCCATCTTCCTTGTTGCGATCAAATTCCGGTTTATTGGGTGGTCAAGGGGGCGGCTCTATGCCTTCTCAATCCGGCTTTCCTTCCCTTGTTTCACCTCGTACTCAGTTTAACAACATGAACATGCTTGGAAACGTGCCAAATGTATCTTCCCTCCTTCATCAATCTTACGGTAATGGCGGAGGCCCAAGTTCCGGAAATACCCTCAGGGGTAT...

Protein

Download Protein FASTA

864 aa · TkA08G101320|TK1151|PROTEIN

MVPPGPPTPLAGSQSVPSSLLRSNSGLLGGQGGGSMPSQSGFPSLVSPRTQFNNMNMLGNVPNVSSLLHQSYGNGGGPSSGNTLRGIIDNGADSDLLSNIGNGMGNFNTPSSSLGPSNMINSNTPNQGQSQGQHFQNSSGNQILPDQQQNQPSNMRQAQQYGLPNNNHQQQQQYQTSQGGLGGQVKMEPQMANDQHGHGQSQGQNQGQNPQQMQALRNLGPVKMESQQVQTMRNLPPVKMEPQHSDQSLFLHQQQQQQQQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G101320`
TK1151 ID	TkA08G101320
OH-1004 ID	LXL04_031323
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G101320

Location Chr08:26285016-26291059 (-)

Description Similar to SEU: Transcriptional corepressor SEUSS

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g43850`	DNA-binding adapter subunit of the SEU-LUG transcriptional corepressor of the C class floral homeotic gene AGAMOUS during the early stages of floral meristem development.	No verified direct reference in this release
`At5g62090`	Probable transcription regulator that functions in the development of the carpel margin meristem similarly to SEUSS (SEU).	SEUSS and SEUSS-LIKE transcriptional adaptors regulate floral and embryonic development in Arabidopsis.2010 · DOI: 10.1104/pp.109.146183 Involvement of co-repressor LUH and the adapter proteins SLK1 and SLK2 in the regulation of abiotic stress response genes in Arabidopsis.2014 · DOI: 10.1186/1471-2229-14-54
`At4g25515`	Probable transcription regulator that functions in the development of the carpel margin meristem similarly to SEUSS (SEU).	No verified direct reference in this release
`At4g25520`	Probable transcription regulator that functions in the development of the carpel margin meristem similarly to SEUSS (SEU).	Involvement of co-repressor LUH and the adapter proteins SLK1 and SLK2 in the regulation of abiotic stress response genes in Arabidopsis.2014 · DOI: 10.1186/1471-2229-14-54

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031323 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0001666 response to hypoxia Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006974 DNA damage response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009624 response to nematode Biological Process

GO:0009733 response to auxin Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

KEGG gene cross-reference

ath:AT1G43850

ath:AT4G25515

ath:AT4G25520

ath:AT5G62090

mgr:MGG_01057

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · TkA08G101320 · TK1151

Cytoplasm0.098

Rank 2 · TkA08G101320 · TK1151

Cell membrane0.022

Rank 3 · TkA08G101320 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA08G101320 · TK1151

Plastid0.007

Rank 5 · TkA08G101320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01803LIM_bind170-200 aa

PF01803LIM_bind249-299 aa

PF01803LIM_bind347-601 aa

PF01803LIM_bind618-657 aa

PF01803LIM_bind819-848 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G101320	`PF01803`	LIM_bind	170	200	2.2e-69	234.3
TkA08G101320	`PF01803`	LIM_bind	249	299	2.2e-69	234.3
TkA08G101320	`PF01803`	LIM_bind	347	601	2.2e-69	234.3
TkA08G101320	`PF01803`	LIM_bind	618	657	2.2e-69	234.3
TkA08G101320	`PF01803`	LIM_bind	819	848	2.2e-69	234.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W234`	Arabidopsis thaliana	sp\|Q8W234\|SEUSS_ARATH Transcriptional corepressor SEUSS	55.000%	Swiss-Prot	High
`Q94BP0`	Arabidopsis thaliana	sp\|Q94BP0\|SLK2_ARATH Probable transcriptional regulator SLK2	56.900%	Swiss-Prot	Low
`F4JT98`	Arabidopsis thaliana	sp\|F4JT98\|SLK3_ARATH Probable transcriptional regulator SLK3	53.800%	Swiss-Prot	Low
`Q0WVM7`	Arabidopsis thaliana	sp\|Q0WVM7\|SLK1_ARATH Probable transcriptional regulator SLK1	54.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card