Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1386 bp · TkA08G100550|TK1151|cDNA
AAAAAAATAGGTAACATTATCAGTTATATTCATTTAGTTCAAACCCCTGTCCTGTCCCCCAGTTCCATTCTGTATCAACGAAGAAGAACCCTAACTTTTTCACTCCAATTGAGATTGAAGCGTGAGATCTGTTTGTTGAAGGGAATATGTCGAATCCACCGAATTCATCTGCATCTTCTTCTTCCCAATTCACCTACTCCAACAACAACGGATCCTATTTTCCAATGCCGTTCCACCTTCAACAACCCCAAACATATCCT...
555 bp · TkA08G100550|TK1151|CDS
ATGTCGAATCCACCGAATTCATCTGCATCTTCTTCTTCCCAATTCACCTACTCCAACAACAACGGATCCTATTTTCCAATGCCGTTCCACCTTCAACAACCCCAAACATATCCTGCTGCTACTCCTCCTCCTCCGCCTCCCGTTCAATTCCCCGCTCCACCTCCCGTCTACCCTAATCCGTCTACTTCTGTCCCTGGAGTCTACTTCCCTCAGTTCCAGCAGGCACAACAGCTATTTCAAAGGGATGCACAGACAATTAC...
Protein
Download Protein FASTA184 aa · TkA08G100550|TK1151|PROTEIN
MSNPPNSSASSSSQFTYSNNNGSYFPMPFHLQQPQTYPAATPPPPPPVQFPAPPPVYPNPSTSVPGVYFPQFQQAQQLFQRDAQTITPEALESVKAALASSEVEHKAEVKKRAIPRKAAGQAWEDPTLAEWPENDYRLFCGDLGNEVNDDVLSKAFHRFPSFNMAKVSFFISFITIIIILYSWA
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G100550 |
|---|---|
| TK1151 ID | TkA08G100550 |
| OH-1004 ID | LXL04_031297 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 90.761 / OH-1004 68.443Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G100550 |
|---|---|
| Location | Chr08:26077801-26080826 (+) |
| Description | Similar to Rbm42: RNA-binding protein 42 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000387 spliceosomal snRNP assembly Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0048025 negative regulation of mRNA splicing, via spliceosome Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005681 spliceosomal complex Cellular Component GO:0005737 cytoplasm Cellular Component GO:0046540 U4/U6 x U5 tri-snRNP complex Cellular Component GO:0071011 precatalytic spliceosome Cellular Component GO:0003723 RNA binding Molecular Function GO:0003729 mRNA binding Molecular Function |
| KEGG gene cross-reference | bta:540172 hsa:79171 mmu:68035 rno:361545 xtr:493283 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.