TkA08G100380 | RubberDandelionOmics

Gene overview

TkA08G100380

Reference: TK1151 Chr: Chr08 Coordinates: 26023328-26025309 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1560 bp · TkA08G100380|TK1151|cDNA

CTTGAGATTGTATAAATTACACTTACGCCGATTGTGTTTTGTGCAGTTTGTCATGGGCGAAAGCAGCAAGGGCTCGATGATGGAAGAAGTTAAAAATCACCCAAAAAATACCGATAAACGGATAAAGATTGAAGAACTCATGGAGAAAGGGGGAGATGATAAAATCAGTGCGTTACCTGATTGCGTGCTTCATGAAATCCTCTCTCGTTTACCCTCCACAAAATATGCCATTAGAACAGGTACACTCTCAAAGCGATGGA...

CDS

Download CDS FASTA

1653 bp · TkA08G100380|TK1151|CDS

AAAAATCCGAAAATTAGGTTATTTAAACTTAAAAAAAATCCAAAATTCAAAGTTGAGGGAGTAAAGCAAAACTTGAGATTGTATAAATTACACTTACGCCGATTGTGTTTTGTGCAGTTTGTCATGGGCGAAAGCAGCAAGGGCTCGATGATGGAAGAAGTTAAAAATCACCCAAAAAATACCGATAAACGGATAAAGATTGAAGAACTCATGGAGAAAGGGGGAGATGATAAAATCAGTGCGTTACCTGATTGCGTGCT...

Protein

Download Protein FASTA

550 aa · TkA08G100380|TK1151|PROTEIN

KNPKIRLFKLKKNPKFKVEGVKQNLRLYKLHLRRLCFVQFVMGESSKGSMMEEVKNHPKNTDKRIKIEELMEKGGDDKISALPDCVLHEILSRLPSTKYAIRTGTLSKRWTHLWTWVHTLILKLSYDPYRSVENPNLISDFVFSVSKTITQYRQLKKFKVDTFYDMQFEVQYNNWIRHAINCNVEELDLNFRSVCRELDLQKEFPSLADDLWLDQSNFFINSCFTYLRLSGLTLNPSGAISWKNLRSLCISSQNLNEDLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G100380`
TK1151 ID	TkA08G100380
OH-1004 ID	LXL04_031293
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	81.300
Protein coverage (%)	TK1151 91.091 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G100380

Location Chr08:26023328-26025309 (-)

Description Similar to FBL25: F-box/LRR-repeat protein 25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g49610`	Putative F-box protein At1g49610.	No verified direct reference in this release
`At3g03360`	F-box/LRR-repeat protein At3g03360.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release
`At5g22700`	F-box/FBD/LRR-repeat protein At5g22700.	No verified direct reference in this release
`At5g22660`	F-box/FBD/LRR-repeat protein At5g22660.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031293 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

ath:AT5G02920

ath:AT5G02930

ath:AT5G03100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.839

Rank 1 · TkA08G100380 · TK1151

Cytoplasm0.217

Rank 2 · TkA08G100380 · TK1151

Cell membrane0.043

Rank 3 · TkA08G100380 · TK1151

Endoplasmic reticulum0.036

Rank 4 · TkA08G100380 · TK1151

Mitochondrion0.016

Rank 5 · TkA08G100380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box79-118 aa

PF12937F-box-like79-111 aa

PF07723LRR_284-95 aa

PF23622LRR_At1g61320_AtMIF1155-279 aa

PF24758LRR_At5g56370173-278 aa

PF13516LRR_6181-191 aa

PF12799LRR_4183-190 aa

PF00646F-box189-197 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G100380	`PF00646`	F-box	79	118	0.0013	19.3
TkA08G100380	`PF12937`	F-box-like	79	111	0.074	13.5
TkA08G100380	`PF07723`	LRR_2	84	95	0.73	11.3
TkA08G100380	`PF23622`	LRR_At1g61320_AtMIF1	155	279	1e-19	71.9
TkA08G100380	`PF24758`	LRR_At5g56370	173	278	8.1e-18	65.6
TkA08G100380	`PF13516`	LRR_6	181	191	0.1	13.4
TkA08G100380	`PF12799`	LRR_4	183	190	0.1	13.6
TkA08G100380	`PF00646`	F-box	189	197	0.0013	19.3
TkA08G100380	`PF13516`	LRR_6	221	239	0.1	13.4
TkA08G100380	`PF12799`	LRR_4	226	259	0.1	13.6
TkA08G100380	`PF07723`	LRR_2	245	268	0.73	11.3
TkA08G100380	`PF00646`	F-box	254	265	0.0013	19.3
TkA08G100380	`PF23622`	LRR_At1g61320_AtMIF1	303	477	1e-19	71.9
TkA08G100380	`PF24758`	LRR_At5g56370	320	466	8.1e-18	65.6
TkA08G100380	`PF13516`	LRR_6	358	377	0.1	13.4
TkA08G100380	`PF12799`	LRR_4	380	415	0.1	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FX89`	Arabidopsis thaliana	sp\|Q9FX89\|FB50_ARATH Putative F-box protein At1g49610	33.700%	Swiss-Prot	Low
`Q84W80`	Arabidopsis thaliana	sp\|Q84W80\|FBL42_ARATH F-box/LRR-repeat protein At3g03360	29.800%	Swiss-Prot	Low
`Q6NKX3`	Arabidopsis thaliana	sp\|Q6NKX3\|FDL14_ARATH F-box/FBD/LRR-repeat protein At2g04230	31.900%	Swiss-Prot	Low
`Q9FNJ1`	Arabidopsis thaliana	sp\|Q9FNJ1\|FDL47_ARATH F-box/FBD/LRR-repeat protein At5g22700	29.400%	Swiss-Prot	Low
`Q9FNJ5`	Arabidopsis thaliana	sp\|Q9FNJ5\|FDL31_ARATH F-box/FBD/LRR-repeat protein At5g22660	24.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card