TkA08G100260 | RubberDandelionOmics

Gene overview

TkA08G100260

Reference: TK1151 Chr: Chr08 Coordinates: 25997384-26004916 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2502 bp · TkA08G100260|TK1151|cDNA

GAAAAAATGAGATAATGACAGAAATGCCCCTGACCTAAACCCATAAGTCTAAAAGAAGACGGGACAAAGCTAATAAAAATTGGACAAAACTTCCCCTGGGTACTAACAAGTTTGTCATGGGGGAAAGCAGCAAGGGCTCGATGATGGAAGAAGGTCAAAATCACCCAAAAATTGCCGATAAACGGATTAAGATTGAAGAACTCACGGAGAAGGGGGGAGATGATAAAATCAGTGCGTTACCTGATTGCCTGCTTCTCGAA...

CDS

Download CDS FASTA

1644 bp · TkA08G100260|TK1151|CDS

ATGATAAAATCAGTGCGTTACCTGATTGCGTGCTTCATGAAATCCTCTCTCGTTTACCCTCCACAAAAGATGCCATTAGAACAGTTTGTCATGGGGGAAAGCAGCAAGGGCTCGATGATGGAAGAAGGTCAAAATCACCCAAAAATTGCCGATAAACGGATTAAGATTGAAGAACTCACGGAGAAGGGGGGAGATGATAAAATCAGTGCGTTACCTGATTGCCTGCTTCTCGAAATCCTCTCTCGTTTACCCTCCACAAA...

Protein

Download Protein FASTA

547 aa · TkA08G100260|TK1151|PROTEIN

MIKSVRYLIACFMKSSLVYPPQKMPLEQFVMGESSKGSMMEEGQNHPKIADKRIKIEELTEKGGDDKISALPDCLLLEILSRLPSTKYAIRTGTLSKRWTHLWTWIPTLIFRLSYDPYRSLENPNLDSDFVLSVSKTLTQCRRLKKFKVDTFYGMQFEVQYTNWIRHAINCNVEELDLNIRSLGKELGLRKEFPSLEEDLWLDQSNFFINSCFTDLKLSGIALHDLHPSGAISWKNLRSLLISSQNLNNEELIVNILSGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G100260`
TK1151 ID	TkA08G100260
OH-1004 ID	LXL04_031293
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	77.700
Protein coverage (%)	TK1151 93.053 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G100260

Location Chr08:25997384-26004916 (-)

Description Similar to FBL25: F-box/LRR-repeat protein 25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g49610`	Putative F-box protein At1g49610.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release
`At2g26860`	FBD-associated F-box protein At2g26860.	No verified direct reference in this release
`At3g51530`	F-box/FBD/LRR-repeat protein At3g51530.	No verified direct reference in this release
`At3g03360`	F-box/LRR-repeat protein At3g03360.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031293 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

ath:AT5G02920

ath:AT5G02930

ath:AT5G03100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.861

Rank 1 · TkA08G100260 · TK1151

Cytoplasm0.189

Rank 2 · TkA08G100260 · TK1151

Cell membrane0.041

Rank 3 · TkA08G100260 · TK1151

Endoplasmic reticulum0.034

Rank 4 · TkA08G100260 · TK1151

Plastid0.016

Rank 5 · TkA08G100260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box68-106 aa

PF12937F-box-like68-100 aa

PF23622LRR_At1g61320_AtMIF1144-272 aa

PF24758LRR_At5g56370163-271 aa

PF13516LRR_6170-179 aa

PF07723LRR_2237-261 aa

PF23622LRR_At1g61320_AtMIF1302-479 aa

PF24758LRR_At5g56370317-463 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G100260	`PF00646`	F-box	68	106	0.00037	21.0
TkA08G100260	`PF12937`	F-box-like	68	100	0.044	14.3
TkA08G100260	`PF23622`	LRR_At1g61320_AtMIF1	144	272	2.3e-14	54.3
TkA08G100260	`PF24758`	LRR_At5g56370	163	271	1.5e-16	61.5
TkA08G100260	`PF13516`	LRR_6	170	179	3.3	8.7
TkA08G100260	`PF07723`	LRR_2	237	261	0.027	15.8
TkA08G100260	`PF23622`	LRR_At1g61320_AtMIF1	302	479	2.3e-14	54.3
TkA08G100260	`PF24758`	LRR_At5g56370	317	463	1.5e-16	61.5
TkA08G100260	`PF13516`	LRR_6	355	374	3.3	8.7
TkA08G100260	`PF13516`	LRR_6	378	392	3.3	8.7
TkA08G100260	`PF07723`	LRR_2	379	402	0.027	15.8
TkA08G100260	`PF00646`	F-box	388	399	0.00037	21.0
TkA08G100260	`PF13516`	LRR_6	401	412	3.3	8.7
TkA08G100260	`PF13516`	LRR_6	416	425	3.3	8.7
TkA08G100260	`PF07723`	LRR_2	424	431	0.027	15.8
TkA08G100260	`PF16493`	Meis_PKNOX_N	500	531	0.075	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FX89`	Arabidopsis thaliana	sp\|Q9FX89\|FB50_ARATH Putative F-box protein At1g49610	35.000%	Swiss-Prot	Low
`Q6NKX3`	Arabidopsis thaliana	sp\|Q6NKX3\|FDL14_ARATH F-box/FBD/LRR-repeat protein At2g04230	32.600%	Swiss-Prot	Low
`Q84X02`	Arabidopsis thaliana	sp\|Q84X02\|FBD7_ARATH FBD-associated F-box protein At2g26860	31.500%	Swiss-Prot	Low
`Q501E9`	Arabidopsis thaliana	sp\|Q501E9\|FDL20_ARATH F-box/FBD/LRR-repeat protein At3g51530	31.100%	Swiss-Prot	Low
`Q84W80`	Arabidopsis thaliana	sp\|Q84W80\|FBL42_ARATH F-box/LRR-repeat protein At3g03360	29.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card