TkA08G099140 | RubberDandelionOmics

Gene overview

TkA08G099140

Reference: TK1151 Chr: Chr08 Coordinates: 25694860-25697143 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1281 bp · TkA08G099140|TK1151|cDNA

CAGATTTTGTGTATTATTAAAATTAGATTGGCATTTTAGGGGTCCAATTTCCATTGTATACCAAATCTTTCTTCATGAAGGTCAGAGCACCGGTCCATGGACCCTTTGTGAGTTTTTCTACTTCACCACTCAAACCGGTGTTAAATATCAGAAGCCAGTAGTGGTGGCAGGGGGGTGTTGCTGTGTGCAGTTGAGGAACGAGGGAATTGAGAGCGACTCCGAATCGGAGCCATGGCTTCCTGTCCTTATTTGAACTCTTC...

CDS

Download CDS FASTA

891 bp · TkA08G099140|TK1151|CDS

ATGGCTTCCTGTCCTTATTTGAACTCTTCTACGATGTTATCGAAGCCCAAACATCCGAATGCTTCGTTTTGTCTCCATGAATTCCCCAATCCACAGCATTCATCATCATCGTCATTGTCATTCTCCGCCTCTCCTGTTGCTACTGTCAGTTCTGCTAGACGCCGGTGTAGGCAAACAAATCGACGGTCTTCCTTGCAGATTTTGGCATCGATGGATAAATCTCGGGAGCCTTTGAAAATTATGATATCCGGAGCTCCTGC...

Protein

Download Protein FASTA

296 aa · TkA08G099140|TK1151|PROTEIN

MASCPYLNSSTMLSKPKHPNASFCLHEFPNPQHSSSSSLSFSASPVATVSSARRRCRQTNRRSSLQILASMDKSREPLKIMISGAPASGKGTQCELITSKYDLVHIAAGDLLRAEVAAGSANGKQAKEYMEKGQLVPDEIVVMMVKDRLSQPDSTEKGWLLDGYPRSSSQATALQSFGFHPDLFILLEVPQEILVDRVVGRRLDPVTGRIYHLTYSPPENEEIAARLTQRFDDTEEKVKLRLQTHNQNVESVLSMFEDIT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G099140`
TK1151 ID	TkA08G099140
OH-1004 ID	LXL04_031276
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G099140

Location Chr08:25694860-25697143 (-)

Description Similar to At5g47840: Adenylate kinase 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47840`	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP.	No verified direct reference in this release
`At5g35170`	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0109300`	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP.	No verified direct reference in this release
`Os08g0288200`	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031276 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0097009 energy homeostasis Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0004017 AMP kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT5G35170

ath:AT5G47840

dosa:Os08g0109300

dosa:Os08g0288200

osa:4345177

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.973

Rank 1 · TkA08G099140 · TK1151

Mitochondrion0.050

Rank 2 · TkA08G099140 · TK1151

Cytoplasm0.024

Rank 3 · TkA08G099140 · TK1151

Nucleus0.019

Rank 4 · TkA08G099140 · TK1151

Peroxisome0.013

Rank 5 · TkA08G099140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06414Zeta_toxin72-109 aa

PF13238AAA_1880-206 aa

PF00406ADK82-258 aa

PF13207AAA_1784-202 aa

PF02223Thymidylate_kin87-148 aa

PF27567RALGAPA1_N113-142 aa

PF02223Thymidylate_kin175-203 aa

PF05191ADK_lid201-223 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G099140	`PF06414`	Zeta_toxin	72	109	0.068	13.3
TkA08G099140	`PF13238`	AAA_18	80	206	2.9e-05	25.3
TkA08G099140	`PF00406`	ADK	82	258	1.1e-48	165.9
TkA08G099140	`PF13207`	AAA_17	84	202	2e-26	93.6
TkA08G099140	`PF02223`	Thymidylate_kin	87	148	7.1e-05	23.3
TkA08G099140	`PF27567`	RALGAPA1_N	113	142	0.12	12.8
TkA08G099140	`PF02223`	Thymidylate_kin	175	203	7.1e-05	23.3
TkA08G099140	`PF05191`	ADK_lid	201	223	0.015	15.9
TkA08G099140	`PF23054`	UBA_N4BP1_C	216	247	0.17	12.4
TkA08G099140	`PF02223`	Thymidylate_kin	221	276	7.1e-05	23.3
TkA08G099140	`PF13207`	AAA_17	222	244	2e-26	93.6
TkA08G099140	`PF27567`	RALGAPA1_N	228	289	0.12	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIJ7`	Arabidopsis thaliana	sp\|Q9FIJ7\|KAD2_ARATH Adenylate kinase 2, chloroplastic	79.300%	Swiss-Prot	High
`Q8VYL1`	Arabidopsis thaliana	sp\|Q8VYL1\|KAD5_ARATH Adenylate kinase 5, chloroplastic	57.600%	Swiss-Prot	High
`Q6ZC69`	Oryza sativa subsp. japonica	sp\|Q6ZC69\|KAD2_ORYSJ Probable adenylate kinase 2, chloroplastic	64.000%	Swiss-Prot	High
`Q0J6P7`	Oryza sativa subsp. japonica	sp\|Q0J6P7\|KAD5_ORYSJ Probable adenylate kinase 5, chloroplastic	53.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card