TkA08G097800 | RubberDandelionOmics

Gene overview

TkA08G097800

Reference: TK1151 Chr: Chr08 Coordinates: 25325717-25328021 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1153 bp · TkA08G097800|TK1151|cDNA

GTAGAGTGTCAATTTTACTCGAATTCTTAACGATTAAGAACGAAATCAGTTTCTTCCGTCGGCTTACGACTTTCAAATCCGATTTCGCGTTGATCTGAAAGCCAAATGCAGCTGTATCATCACCCGTATTCAATCGAGAGCCAGAAAGTGCGGCTCGCTTTAGAAGAACGGAATATCGACTACACCTCCTACCATGTCAATCCCGTCACAGGCAAAAACATGGATCCTTCATTTTTCAGGATGAATCCAACCGCGAATCT...

CDS

Download CDS FASTA

804 bp · TkA08G097800|TK1151|CDS

ATGCAGCTGTATCATCACCCGTATTCAATCGAGAGCCAGAAAGTGCGGCTCGCTTTAGAAGAACGGAATATCGACTACACCTCCTACCATGTCAATCCCGTCACAGGCAAAAACATGGATCCTTCATTTTTCAGGATGAATCCAACCGCGAATCTTCCCGTTTTCCAAAACGGGTCCCATGTTATCTTCAACACCATAGATATCATCCAATATATAGAGCGGATTGCTCTCGTCTCTTCAGGAAGTGGAATCATAACACA...

Protein

Download Protein FASTA

267 aa · TkA08G097800|TK1151|PROTEIN

MQLYHHPYSIESQKVRLALEERNIDYTSYHVNPVTGKNMDPSFFRMNPTANLPVFQNGSHVIFNTIDIIQYIERIALVSSGSGIITQSSKQVIEWMHKIQEWNPKYFTFSHIPEKYYIFVSKFIRRVIIARMSESPDLATAYHTKLKQAYETEEKLRDPQVLQASEQHLIRLLDDVECQLEQTLYLTGDEFTLADVMLVPVLARLGLLGLEDEYVNCRPKLGEYWRLVKERPSYKKVIGKYFCGWKRRKTLLKTWCIVRM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G097800`
TK1151 ID	TkA08G097800
OH-1004 ID	LXL04_031265
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G097800

Location Chr08:25325717-25328021 (-)

Description Similar to TCHQD: Glutathione S-transferase TCHQD

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g77290`	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031265 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000266 mitochondrial fission Biological Process

GO:0006626 protein targeting to mitochondrion Biological Process

GO:0006749 glutathione metabolic process Biological Process

GO:0008053 mitochondrial fusion Biological Process

GO:0009635 response to herbicide Biological Process

GO:0009636 response to toxic substance Biological Process

GO:0019338 pentachlorophenol catabolic process Biological Process

GO:0071305 cellular response to vitamin D Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

KEGG gene cross-reference

ath:AT1G77290

hsa:54332

hsa:78997

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.568

Rank 1 · TkA08G097800 · TK1151

Cytoplasm0.262

Rank 2 · TkA08G097800 · TK1151

Nucleus0.122

Rank 3 · TkA08G097800 · TK1151

Cell membrane0.070

Rank 4 · TkA08G097800 · TK1151

Peroxisome0.063

Rank 5 · TkA08G097800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02798GST_N1-74 aa

PF13417GST_N_33-75 aa

PF13409GST_N_212-74 aa

PF22777VKGC_lumenal_dom114-162 aa

PF13417GST_N_3120-131 aa

PF14497GST_C_3146-235 aa

PF00043GST_C159-211 aa

PF13410GST_C_2160-209 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G097800	`PF02798`	GST_N	1	74	8e-12	46.0
TkA08G097800	`PF13417`	GST_N_3	3	75	7.8e-12	46.1
TkA08G097800	`PF13409`	GST_N_2	12	74	1.1e-10	42.7
TkA08G097800	`PF22777`	VKGC_lumenal_dom	114	162	0.036	14.7
TkA08G097800	`PF13417`	GST_N_3	120	131	7.8e-12	46.1
TkA08G097800	`PF14497`	GST_C_3	146	235	4.1e-06	27.7
TkA08G097800	`PF00043`	GST_C	159	211	3.4e-05	24.7
TkA08G097800	`PF13410`	GST_C_2	160	209	8.9e-08	32.9
TkA08G097800	`PF16865`	GST_C_5	181	205	0.034	15.4
TkA08G097800	`PF13417`	GST_N_3	205	234	7.8e-12	46.1
TkA08G097800	`PF13409`	GST_N_2	205	217	1.1e-10	42.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80662`	Arabidopsis thaliana	sp\|O80662\|TCHQD_ARATH Glutathione S-transferase TCHQD	65.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card