TkA08G097770 | RubberDandelionOmics

Gene overview

TkA08G097770

Reference: TK1151 Chr: Chr08 Coordinates: 25314087-25316327 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1046 bp · TkA08G097770|TK1151|cDNA

CAAACACCCACAAACATATACACCTTTGCTGCCCATTTGGAAAGTCTCTTGTCTTCCAGCCATTACCAAAACTCTATTTTTCTCTCTCTCTCTAGATCTTTCTTTCTCTCTCTCTCTCTCATTCTCTCTCTCATTCTGCTAATTAACTCTTGTACGTAGCTTCATAAAGTCTTTTCATTCTTATCGGTAATTAAGCAGTTTGAGAGAGAATGGGAAGAGGAAAGACAGAGATCAAAAGGATAGAAAACATTAGCAACAGG...

CDS

Download CDS FASTA

591 bp · TkA08G097770|TK1151|CDS

ATGGGAAGAGGAAAGACAGAGATCAAAAGGATAGAAAACATTAGCAACAGGCAAGTCACATACTCAAAGAGAAAAAATGGAATCATCAAGAAAGCTAAAGAAATCACTGTTCTTTGTGATGCTAATGTCTCTCTTGTTATCTGCGGCTCTTCCGGAAAGATGTATGAATACTGTAGCCCCAAAACCAACTTGATTGACATGGTGGATCGATATCAAAGGCTTTCTGGAAATAAGTTGTGGGATGCTAAACATGAGAATCT...

Protein

Download Protein FASTA

196 aa · TkA08G097770|TK1151|PROTEIN

MGRGKTEIKRIENISNRQVTYSKRKNGIIKKAKEITVLCDANVSLVICGSSGKMYEYCSPKTNLIDMVDRYQRLSGNKLWDAKHENLQNEIDRIKKENENMQNELRHLGGEDITSLNFEELIAYEDALENGLTNIRVKKDEIPKIMRKHEQVLEEENTHLMYLVQQGEMAAMGDYQVQESFSFRGQPMQPNLHERM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G097770`
TK1151 ID	TkA08G097770
OH-1004 ID	LXL04_031264
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G097770`
Location	Chr08:25314087-25316327 (-)
Description	Similar to PMADS2: Floral homeotic protein PMADS 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031264` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0010095 specification of petal identity Biological Process GO:0010097 specification of stamen identity Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0005634 nucleus Cellular Component GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding Molecular Function GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function GO:0003700 DNA-binding transcription factor activity Molecular Function GO:0046983 protein dimerization activity Molecular Function
KEGG gene cross-reference	nta:107829524 vvi:100232978 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.961

Rank 1 · TkA08G097770 · TK1151

Cytoplasm0.097

Rank 2 · TkA08G097770 · TK1151

Cell membrane0.020

Rank 3 · TkA08G097770 · TK1151

Endoplasmic reticulum0.012

Rank 4 · TkA08G097770 · TK1151

Plastid0.010

Rank 5 · TkA08G097770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28175T4SS_LegC2C73-19 aa

PF06698DUF11925-15 aa

PF19776DUF62629-36 aa

PF00319SRF-TF10-57 aa

PF27247MJ167312-32 aa

PF01486K-box14-31 aa

PF04977DivIC15-42 aa

PF29997SPC25_N21-25 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G097770	`PF28175`	T4SS_LegC2C7	3	19	0.00026	20.7
TkA08G097770	`PF06698`	DUF1192	5	15	0.31	11.9
TkA08G097770	`PF19776`	DUF6262	9	36	0.13	13.2
TkA08G097770	`PF00319`	SRF-TF	10	57	2.6e-21	75.5
TkA08G097770	`PF27247`	MJ1673	12	32	0.21	12.3
TkA08G097770	`PF01486`	K-box	14	31	1.1e-18	67.9
TkA08G097770	`PF04977`	DivIC	15	42	0.065	13.8
TkA08G097770	`PF29997`	SPC25_N	21	25	0.037	15.0
TkA08G097770	`PF05325`	DUF730	30	106	0.029	15.1
TkA08G097770	`PF03710`	GlnE	47	122	0.17	12.0
TkA08G097770	`PF29997`	SPC25_N	61	160	0.037	15.0
TkA08G097770	`PF19776`	DUF6262	68	107	0.13	13.2
TkA08G097770	`PF11932`	DUF3450	79	166	0.023	14.7
TkA08G097770	`PF28175`	T4SS_LegC2C7	81	167	0.00026	20.7
TkA08G097770	`PF04977`	DivIC	81	112	0.065	13.8
TkA08G097770	`PF06156`	YabA	81	108	5.3	8.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card