TkA08G097730 | RubberDandelionOmics

Gene overview

TkA08G097730

Reference: TK1151 Chr: Chr08 Coordinates: 25286710-25290141 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2297 bp · TkA08G097730|TK1151|cDNA

GAAAGCCGATGTGGCAAGATATAGCGGACCCGCAATCTTCGAAATACGCTACCAAATTGTGGAGCAGACGCCGTTGAATCATTTCCACTTGTCAGCGCATGGAAGGCCAACCGAGATCGCGCACCACACAAACCACATATCCACAAATTCCCTCGATTAATCTCCTTTCCTACAAAACTCTTCAATTTTCTCTCTCTTCTGGTCATTTTTCAATCGCCATGACCGCCATTGCTACAGCTGCAGCTCTATCTCTTCCAATA...

CDS

Download CDS FASTA

888 bp · TkA08G097730|TK1151|CDS

ATGCCAATTGATTGCTTTGAAGAACCATGGGTGTTATTCCGCGGGAAAGATGGGAAACCAGGGTGTATAAGGAACACGTGTGCACATAGAGCATGCCCTCTTGATTTAGGAACTGTAAACGAGGGACGTGTCCAATGTCCCTACCATGGGTGGGAGTACTCTACAAATGGAAACTGCGAGAAAATGCCTTCAACGAAATTCGTTAACGTGAAGATAAAAGCACTTGCATGTTTTGAGCAAGAAGGAATGATATGGATCTG...

Protein

Download Protein FASTA

295 aa · TkA08G097730|TK1151|PROTEIN

MPIDCFEEPWVLFRGKDGKPGCIRNTCAHRACPLDLGTVNEGRVQCPYHGWEYSTNGNCEKMPSTKFVNVKIKALACFEQEGMIWIWPGNEPSEPTVPSLLPPQGFQIHAEIVMELPVEHGLLLDNLLDLAHAPFTHTSTFAKGWSVPSLVKFLTPTSGLEGYWDPYPIDMEFRPPCIVLSTIGISKPGKLEGQSTKQCATHLHQLHICLPSSRNKTRLLYRMSLDFAPILQFVPFMHILWRHFAEKVLNEDLRLVVGQQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G097730`
TK1151 ID	TkA08G097730
OH-1004 ID	LXL04_031260
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	91.500
Protein coverage (%)	TK1151 100.000 / OH-1004 57.271 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G097730

Location Chr08:25286710-25290141 (-)

Description Similar to CAO: Chlorophyllide a oxygenase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g44446`	Catalyzes a two-step oxygenase reaction involved in the synthesis of chlorophyll b.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0567400`	Catalyzes a two-step oxygenase reaction involved in the synthesis of chlorophyll b.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031260 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015031 protein transport Biological Process

GO:0015995 chlorophyll biosynthetic process Biological Process

GO:0045036 protein targeting to chloroplast Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0042651 thylakoid membrane Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0010277 chlorophyllide a oxygenase activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT1G44446

cre:CHLRE_01g043350v5

dosa:Os10g0567400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.901

Rank 1 · TkA08G097730 · TK1151

Cytoplasm0.064

Rank 2 · TkA08G097730 · TK1151

Endoplasmic reticulum0.048

Rank 3 · TkA08G097730 · TK1151

Nucleus0.044

Rank 4 · TkA08G097730 · TK1151

Cell membrane0.032

Rank 5 · TkA08G097730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00355Rieske3-67 aa

PF19112VanA_C119-143 aa

PF19112VanA_C170-290 aa

PF08417PaO173-269 aa

PF00355Rieske187-203 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G097730	`PF00355`	Rieske	3	67	5.2e-20	71.9
TkA08G097730	`PF19112`	VanA_C	119	143	1.7e-16	61.7
TkA08G097730	`PF19112`	VanA_C	170	290	1.7e-16	61.7
TkA08G097730	`PF08417`	PaO	173	269	5.4e-18	65.6
TkA08G097730	`PF00355`	Rieske	187	203	5.2e-20	71.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MBA1`	Arabidopsis thaliana	sp\|Q9MBA1\|CAO_ARATH Chlorophyllide a oxygenase, chloroplastic	83.300%	Swiss-Prot	High
`Q8S7E1`	Oryza sativa subsp. japonica	sp\|Q8S7E1\|CAO_ORYSJ Chlorophyllide a oxygenase, chloroplastic	85.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card