Gene Card
Gene overview
cDNA / CDS / Protein Sequences
519 bp · TkA08G097500|TK1151|cDNA
ATGACGGACACCAAGAGATACGAAGGCACCGTTAAGTGGTTCAGTGGGCAAAAGGGTTTCGGGTTTATTGCTGCAGAAGAAGACAGTGGTGAAGATCTTTTTGTACACCAGTCTGAGATCAAGGCGGAAGGGTTTCGGTTTCTTAGAGATGGACAAAGGGTAGAATTTTCAGTGGAGTCCAGTGAAGATGGGAGGAAGAAGGCGGTGGACGTGGTGACTAGACCGTATTCACCAGGGCTGAGGCGTGGGAGACGTGGGAG...
519 bp · TkA08G097500|TK1151|CDS
ATGACGGACACCAAGAGATACGAAGGCACCGTTAAGTGGTTCAGTGGGCAAAAGGGTTTCGGGTTTATTGCTGCAGAAGAAGACAGTGGTGAAGATCTTTTTGTACACCAGTCTGAGATCAAGGCGGAAGGGTTTCGGTTTCTTAGAGATGGACAAAGGGTAGAATTTTCAGTGGAGTCCAGTGAAGATGGGAGGAAGAAGGCGGTGGACGTGGTGACTAGACCGTATTCACCAGGGCTGAGGCGTGGGAGACGTGGGAG...
Protein
Download Protein FASTA172 aa · TkA08G097500|TK1151|PROTEIN
MTDTKRYEGTVKWFSGQKGFGFIAAEEDSGEDLFVHQSEIKAEGFRFLRDGQRVEFSVESSEDGRKKAVDVVTRPYSPGLRRGRRGRRGGYGGNGGGFRGGGNSVRGGRFGRGGDSDGDGDNDQGGDNEGYDNGRGGGRGTRGGDGRGGRSRQCYHCGEEGHFARECPNDQD
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G097500 |
|---|---|
| TK1151 ID | TkA08G097500 |
| OH-1004 ID | LXL04_019668 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 64.300 |
| Protein coverage (%) | TK1151 40.698 / OH-1004 32.093Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G097500 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:25224446-25225033 (+) | |||||||||
| Description | Similar to CSP4: Cold shock domain-containing protein 4 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009269 response to desiccation Biological Process GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009631 cold acclimation Biological Process GO:0009651 response to salt stress Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0009826 unidimensional cell growth Biological Process GO:0010154 fruit development Biological Process GO:0010228 vegetative to reproductive phase transition of meristem Biological Process GO:0043457 regulation of cellular respiration Biological Process GO:0048316 seed development Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT2G17870 ath:AT2G21060 ath:AT4G36020 ath:AT4G38680 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00313CSD8-72 aaPF08206OB_RNB17-41 aaPF13917zf-CCHC_3150-169 aaPF00098zf-CCHC152-169 aaPF13696zf-CCHC_2154-169 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G097500 | PF00313 | CSD | 8 | 72 | 5.7e-22 | 78.1 |
| TkA08G097500 | PF08206 | OB_RNB | 17 | 41 | 0.003 | 17.9 |
| TkA08G097500 | PF13917 | zf-CCHC_3 | 150 | 169 | 0.19 | 12.3 |
| TkA08G097500 | PF00098 | zf-CCHC | 152 | 169 | 3.7e-08 | 33.8 |
| TkA08G097500 | PF13696 | zf-CCHC_2 | 154 | 169 | 0.26 | 11.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.