TkA08G096710 | RubberDandelionOmics

Gene overview

TkA08G096710

Reference: TK1151 Chr: Chr08 Coordinates: 25010646-25012411 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1102 bp · TkA08G096710|TK1151|cDNA

GGTTCATGGTCTGGTTCAGATTCTATATCAGCTGTACAGAAAGCTTTAGCCACTCAAGAACCCAATTTTCTAGATGCAGAGATAGATAGAACATTACTAAATATCGGGAAAAGAATTGCATCTGGATCTTGTGGGGATTTGTATATACCGTGGAGAGTATAATGGTCAGGATGTTGCTATCAAGATTCATAAATCTGAACATTTAAATGAAAGTTTAGAGGATGAATTCGCCCATGAAGTAGCCATGCTCAAGGAGGTTC...

CDS

Download CDS FASTA

660 bp · TkA08G096710|TK1151|CDS

ATGCTCAAGGAGGTTCAGCATACTAATGTTGTTCGTTTTATTGGTGCATGCACAAAGCAACCTCCTTTATGCATAATAACAGAGTACATGTCTGGAGGGAGTCTGTATGATTACTTACATAACAATAAACATAACGTCTTAATGCTTCCAGAGTTGTTAAAGTTTGGTATAGATGTCTGCAAAGGAATGGAATACTTACACAACAACAACATAATTCATAGGGATCTCAAGACTGCAAATTTGCTTTTAGACTCTCAAAA...

Protein

Download Protein FASTA

219 aa · TkA08G096710|TK1151|PROTEIN

MLKEVQHTNVVRFIGACTKQPPLCIITEYMSGGSLYDYLHNNKHNVLMLPELLKFGIDVCKGMEYLHNNNIIHRDLKTANLLLDSQNVVKVADFGVARFLNQGGVMTAETGTYRWMAPEVINHQQYDQKADVFSFAIVLWELVTSKVPYENMTPMQAALGVRQGLRPDVPTNTHPNLKDLMHKCWDFDPHNRLSFSQIRLQLEELLLEIQDEAKTQNGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G096710`
TK1151 ID	TkA08G096710
OH-1004 ID	LXL04_031243
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 37.955 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G096710

Location Chr08:25010646-25012411 (+)

Description Similar to STY17: Serine/threonine-protein kinase STY17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g38470`	Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).	A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200 The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
`At4g35780`	Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).	A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200 The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
`At2g17700`	Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).	A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200 The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
`At2g24360`	Serine/threonine protein kinase that phosphorylates proteins on serine, threonine and tyrosine residues.	Genome-wide analysis and experimentation of plant serine/ threonine/tyrosine-specific protein kinases.2006 · DOI: 10.1007/s11103-005-4109-7
`At1g62400`	Serine/threonine/tyrosine kinase involved in the control of stomatal movement in response to CO(2).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031243 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010344 seed oilbody biogenesis Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G17700

ath:AT2G24360

ath:AT4G35780

ath:AT4G38470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.665

Rank 1 · TkA08G096710 · TK1151

Nucleus0.344

Rank 2 · TkA08G096710 · TK1151

Cell membrane0.248

Rank 3 · TkA08G096710 · TK1151

Golgi apparatus0.083

Rank 4 · TkA08G096710 · TK1151

Mitochondrion0.063

Rank 5 · TkA08G096710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr1-201 aa

PF00069Pkinase1-198 aa

PF03109ABC125-102 aa

PF17667Pkinase_fungal50-139 aa

PF14531Kinase-like63-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G096710	`PF07714`	PK_Tyr_Ser-Thr	1	201	6.1e-66	223.1
TkA08G096710	`PF00069`	Pkinase	1	198	1.8e-53	182.3
TkA08G096710	`PF03109`	ABC1	25	102	3.8e-05	23.7
TkA08G096710	`PF17667`	Pkinase_fungal	50	139	1.3e-06	28.1
TkA08G096710	`PF14531`	Kinase-like	63	142	0.013	15.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JTP5`	Arabidopsis thaliana	sp\|F4JTP5\|STY46_ARATH Serine/threonine-protein kinase STY46	62.700%	Swiss-Prot	High
`Q8RWL6`	Arabidopsis thaliana	sp\|Q8RWL6\|STY17_ARATH Serine/threonine-protein kinase STY17	60.000%	Swiss-Prot	High
`O22558`	Arabidopsis thaliana	sp\|O22558\|STY8_ARATH Serine/threonine-protein kinase STY8	59.000%	Swiss-Prot	High
`Q9ZQ31`	Arabidopsis thaliana	sp\|Q9ZQ31\|STY13_ARATH Serine/threonine-protein kinase STY13	48.800%	Swiss-Prot	Medium
`Q2MHE4`	Arabidopsis thaliana	sp\|Q2MHE4\|HT1_ARATH Serine/threonine/tyrosine-protein kinase HT1	46.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card