TkA08G096410 | RubberDandelionOmics

Gene overview

TkA08G096410

Reference: TK1151 Chr: Chr08 Coordinates: 24927689-24928383 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

590 bp · TkA08G096410|TK1151|cDNA

TATGAATCAAACCCTTCACAACCATCCTCATATCCTTTCAGATTTTTTAGATCTAAAATCTCATATTCTTTCTTACTTTCTAGATTTGAAATCATGTCAGGATTACCAAAAACAGGTGGTCGCAAGAAAATACAAATGAAAAAGATTGAAAGTGGAAGGGAGCGTGCAGTTACCCTGACAAAGAGACACAATGGCTTATTCAAGAAGGCGCATGAGCTCGCCACATTATGTGGCGTACAAATTGCAGTTATTTGCTTCTC...

CDS

Download CDS FASTA

588 bp · TkA08G096410|TK1151|CDS

TATGAATCAAACCCTTCACAACCATCCTCATATCCTTTCAGATTTTTTAGATCTAAAATCTCATATTCTTTCTTACTTTCTAGATTTGAAATCATGTCAGGATTACCAAAAACAGGTGGTCGCAAGAAAATACAAATGAAAAAGATTGAAAGTGGAAGGGAGCGTGCAGTTACCCTGACAAAGAGACACAATGGCTTATTCAAGAAGGCGCATGAGCTCGCCACATTATGTGGCGTACAAATTGCAGTTATTTGCTTCTC...

Protein

Download Protein FASTA

195 aa · TkA08G096410|TK1151|PROTEIN

YESNPSQPSSYPFRFFRSKISYSFLLSRFEIMSGLPKTGGRKKIQMKKIESGRERAVTLTKRHNGLFKKAHELATLCGVQIAVICFSLSGKPLSFGSPNVLNRKLDELKEELAKETKKGQILQERLRDSLGCNNYEEYIKSLGVEELKELKYKLEELKRNAECELDDISGGSTSANGDHEADLSKIGAPKDYLKM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G096410`
TK1151 ID	TkA08G096410
OH-1004 ID	LXL04_031237
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	82.400
Protein coverage (%)	TK1151 84.103 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G096410

Location Chr08:24927689-24928383 (-)

Description Similar to AGL29: Agamous-like MADS-box protein AGL29

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60440`	Probable transcription factor.	The AGL62 MADS domain protein regulates cellularization during endosperm development in Arabidopsis.2008 · DOI: 10.1105/tpc.107.055137
`At5g27960`	Probable transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0579600`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031237 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009559 embryo sac central cell differentiation Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0009960 endosperm development Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G65360

ath:AT2G24840

ath:AT2G34440

ath:AT5G51870

ath:AT5G60440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.964

Rank 1 · TkA08G096410 · TK1151

Cytoplasm0.099

Rank 2 · TkA08G096410 · TK1151

Cell membrane0.020

Rank 3 · TkA08G096410 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA08G096410 · TK1151

Plastid0.010

Rank 5 · TkA08G096410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01486K-box42-69 aa

PF27241CLIP147-64 aa

PF00319SRF-TF48-95 aa

PF26323EsxC99-117 aa

PF18210Knl1_RWD_C101-180 aa

PF11491DUF3213101-134 aa

PF24260DUF7461101-117 aa

PF27241CLIP1102-162 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G096410	`PF01486`	K-box	42	69	1.5	9.8
TkA08G096410	`PF27241`	CLIP1	47	64	1.1	9.9
TkA08G096410	`PF00319`	SRF-TF	48	95	2.4e-20	72.4
TkA08G096410	`PF26323`	EsxC	99	117	0.054	14.7
TkA08G096410	`PF18210`	Knl1_RWD_C	101	180	0.048	14.5
TkA08G096410	`PF11491`	DUF3213	101	134	0.65	10.9
TkA08G096410	`PF24260`	DUF7461	101	117	3.8	7.9
TkA08G096410	`PF27241`	CLIP1	102	162	1.1	9.9
TkA08G096410	`PF30212`	KBP3	103	170	0.14	13.1
TkA08G096410	`PF01486`	K-box	105	156	1.5	9.8
TkA08G096410	`PF26323`	EsxC	145	180	0.054	14.7
TkA08G096410	`PF11491`	DUF3213	147	160	0.65	10.9
TkA08G096410	`PF24260`	DUF7461	149	166	3.8	7.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKK2`	Arabidopsis thaliana	sp\|Q9FKK2\|AGL62_ARATH Agamous-like MADS-box protein AGL62	51.600%	Swiss-Prot	Low
`Q7XJK5`	Arabidopsis thaliana	sp\|Q7XJK5\|AGL90_ARATH Agamous-like MADS-box protein AGL90	47.800%	Swiss-Prot	Low
`Q6EP49`	Oryza sativa subsp. japonica	sp\|Q6EP49\|MAD27_ORYSJ MADS-box transcription factor 27	41.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card