TkA08G095980 | RubberDandelionOmics

Gene overview

TkA08G095980

Reference: TK1151 Chr: Chr08 Coordinates: 24846796-24848043 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

930 bp · TkA08G095980|TK1151|cDNA

ATGGAGGGCCTTCTAGTATCAAAACTCAAGAGGTGGACATGCTTTACAACCATCAACATCAAGAACGATAAGGAACTCAAAGAATGTAAGAGAGTCATAGATGTGGATGAGGAATATCAAGGGGCATTAAGAAGCAAATCATTTGCCGATTTCTTCTCAAAAGCCCAATTACTTGTACAAGATCCTTCACTGTCCATGACACAATCTTATTGTCATCACAAAGTACTCCTCGAACCTGATCAAGAAACTATAGCTACGAT...

CDS

Download CDS FASTA

930 bp · TkA08G095980|TK1151|CDS

ATGGAGGGCCTTCTAGTATCAAAACTCAAGAGGTGGACATGCTTTACAACCATCAACATCAAGAACGATAAGGAACTCAAAGAATGTAAGAGAGTCATAGATGTGGATGAGGAATATCAAGGGGCATTAAGAAGCAAATCATTTGCCGATTTCTTCTCAAAAGCCCAATTACTTGTACAAGATCCTTCACTGTCCATGACACAATCTTATTGTCATCACAAAGTACTCCTCGAACCTGATCAAGAAACTATAGCTACGAT...

Protein

Download Protein FASTA

309 aa · TkA08G095980|TK1151|PROTEIN

MEGLLVSKLKRWTCFTTINIKNDKELKECKRVIDVDEEYQGALRSKSFADFFSKAQLLVQDPSLSMTQSYCHHKVLLEPDQETIATILESKTMSKNSNLKVLILDYFAISSEASKICMKILKSITQVRSSYVSNQQTLNIFIEDRINNNPIYKISKNDFEVISNKYSSALQKMKVNRRKVDRKLKMISYFNKASGICMTATCGLVAVAAMALAAHTLTALVMGPMIFTLPMKSIKKKVGSLKFLKSRILRRVADQLDVAM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G095980`
TK1151 ID	TkA08G095980
OH-1004 ID	LXL04_031230
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 95.146 / OH-1004 80.328 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G095980

Location Chr08:24846796-24848043 (-)

Description Similar to OsI_009784: UPF0496 protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g49070`	UPF0496 protein At3g49070.	No verified direct reference in this release
`At3g19250`	UPF0496 protein At3g19250.	No verified direct reference in this release
`At3g19330`	UPF0496 protein At3g19330.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XCJ1`	UPF0496 protein 3.	No verified direct reference in this release
`Os03g0148000`	UPF0496 protein 3.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031230 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G20180

ath:AT3G19330

ath:AT3G49070

dosa:Os03g0148000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.318

Rank 1 · TkA08G095980 · TK1151

Nucleus0.252

Rank 2 · TkA08G095980 · TK1151

Mitochondrion0.223

Rank 3 · TkA08G095980 · TK1151

Cell membrane0.219

Rank 4 · TkA08G095980 · TK1151

Endoplasmic reticulum0.146

Rank 5 · TkA08G095980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05055DUF67773-147 aa

PF17021Mei5_like139-193 aa

PF05055DUF677158-285 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G095980	`PF05055`	DUF677	73	147	4.9e-15	56.0
TkA08G095980	`PF17021`	Mei5_like	139	193	0.25	12.1
TkA08G095980	`PF05055`	DUF677	158	285	4.9e-15	56.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SMU4`	Arabidopsis thaliana	sp\|Q9SMU4\|U496N_ARATH UPF0496 protein At3g49070	29.500%	Swiss-Prot	Low
`Q9LJK4`	Arabidopsis thaliana	sp\|Q9LJK4\|U496L_ARATH UPF0496 protein At3g19250	25.100%	Swiss-Prot	Low
`Q9LT84`	Arabidopsis thaliana	sp\|Q9LT84\|U496M_ARATH UPF0496 protein At3g19330	25.400%	Swiss-Prot	Low
`A2XCJ1`	Oryza sativa subsp. indica	sp\|A2XCJ1\|U496C_ORYSI UPF0496 protein 3	26.900%	Swiss-Prot	Low
`Q10RR9`	Oryza sativa subsp. japonica	sp\|Q10RR9\|U496C_ORYSJ UPF0496 protein 3	26.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card