TkA08G095340 | RubberDandelionOmics

Gene overview

TkA08G095340

Reference: TK1151 Chr: Chr08 Coordinates: 24626152-24627406 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1002 bp · TkA08G095340|TK1151|cDNA

AAGGTAATTGATGACTTAAAAGAAGAAGTGACGAAAGAAATATCAGCAAGTTTGAATGATCCCAGTGAATATTTAAATTTGTTAAAACTTGTTGATACAATCCAACGTCTCGGCATTGCATATTACTTTGAAAAGGAGATTAAGGAAGCCTTGCAACACATCTATGATTCATATGGTGACAACTGGACTGGTGTGGGTACTTCCCTTTGGTTTCGACTCATGAGACAACAAGGCTTCTTAGTCCCAAGCGACATCTTCAA...

CDS

Download CDS FASTA

1002 bp · TkA08G095340|TK1151|CDS

AAGGTAATTGATGACTTAAAAGAAGAAGTGACGAAAGAAATATCAGCAAGTTTGAATGATCCCAGTGAATATTTAAATTTGTTAAAACTTGTTGATACAATCCAACGTCTCGGCATTGCATATTACTTTGAAAAGGAGATTAAGGAAGCCTTGCAACACATCTATGATTCATATGGTGACAACTGGACTGGTGTGGGTACTTCCCTTTGGTTTCGACTCATGAGACAACAAGGCTTCTTAGTCCCAAGCGACATCTTCAA...

Protein

Download Protein FASTA

334 aa · TkA08G095340|TK1151|PROTEIN

KVIDDLKEEVTKEISASLNDPSEYLNLLKLVDTIQRLGIAYYFEKEIKEALQHIYDSYGDNWTGVGTSLWFRLMRQQGFLVPSDIFNKYKDTDGAFSYESLNNDVQELLELYEATYVSMPGEVILDDALLFTRNRLHEIAKESNSKQIQDALKQPLHKRLPRLEAIRYIPFYESQTSHNHSLLKLAKLGFNMLQSQHKKELSEISKWWKAFDVPNNLPFARDRLVECYFWATGVYFEPQYSQSRMFLAIVIAIGTILDDT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G095340`
TK1151 ID	TkA08G095340
OH-1004 ID	LXL04_031215
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.800
Protein coverage (%)	TK1151 98.802 / OH-1004 32.911 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G095340`
Location	Chr08:24626152-24627406 (-)
Description	Similar to Alpha-isocomene synthase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031215` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0016102 diterpenoid biosynthetic process Biological Process GO:0051762 sesquiterpene biosynthetic process Biological Process GO:0000287 magnesium ion binding Molecular Function GO:0010333 terpene synthase activity Molecular Function GO:0052682 epi-cedrol synthase activity Molecular Function GO:0080016 (-)-E-beta-caryophyllene synthase activity Molecular Function
KEGG gene cross-reference	ag:AAF80333 ag:AAL79181 ag:AFM43735 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.623

Rank 1 · TkA08G095340 · TK1151

Plastid0.396

Rank 2 · TkA08G095340 · TK1151

Nucleus0.162

Rank 3 · TkA08G095340 · TK1151

Endoplasmic reticulum0.058

Rank 4 · TkA08G095340 · TK1151

Peroxisome0.055

Rank 5 · TkA08G095340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08730Rad332-58 aa

PF01397Terpene_synth3-150 aa

PF04447dATP-dGTP_PPHyd3-52 aa

PF08730Rad3398-114 aa

PF03936Terpene_synth_C211-331 aa

PF19086Terpene_syn_C_2250-326 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G095340	`PF08730`	Rad33	2	58	0.021	15.6
TkA08G095340	`PF01397`	Terpene_synth	3	150	2e-43	149.0
TkA08G095340	`PF04447`	dATP-dGTP_PPHyd	3	52	0.24	12.4
TkA08G095340	`PF08730`	Rad33	98	114	0.021	15.6
TkA08G095340	`PF03936`	Terpene_synth_C	211	331	4.3e-40	138.2
TkA08G095340	`PF19086`	Terpene_syn_C_2	250	326	3.8e-10	40.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card