RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G095200
Reference: TK1151 Chr: Chr08 Coordinates: 24594896-24596698 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1320 bp · TkA08G095200|TK1151|cDNA

ATGGCAAAACCAACAAAGTCAGGACTAGCTCTTCAGCATAAGATAGTTGATGCGAGGAGTACAACCTCCCTTTCAACACCAGATCGTATGTCTTCGCTTTATGTTGGGGACTTGGAGGAGAACGTTAATGAAGGTCAATTGTTTGATCTCTTCAATGAGGTGGGACGAGTTCATTCCGTACGTGTTTGTCGAGATCAAGAAAATGGGGTTTCACTTGGTTATGGCTATGTCAATTTCACTACTTCAGAAGATGGTACTAT...

CDS

Download CDS FASTA

1320 bp · TkA08G095200|TK1151|CDS

ATGGCAAAACCAACAAAGTCAGGACTAGCTCTTCAGCATAAGATAGTTGATGCGAGGAGTACAACCTCCCTTTCAACACCAGATCGTATGTCTTCGCTTTATGTTGGGGACTTGGAGGAGAACGTTAATGAAGGTCAATTGTTTGATCTCTTCAATGAGGTGGGACGAGTTCATTCCGTACGTGTTTGTCGAGATCAAGAAAATGGGGTTTCACTTGGTTATGGCTATGTCAATTTCACTACTTCAGAAGATGGTACTAT...

Protein

Download Protein FASTA

439 aa · TkA08G095200|TK1151|PROTEIN

MAKPTKSGLALQHKIVDARSTTSLSTPDRMSSLYVGDLEENVNEGQLFDLFNEVGRVHSVRVCRDQENGVSLGYGYVNFTTSEDGTIALKFLNFKRLNGKQIRIMFSEPDPTMRRSGVGNVYIKNLDSSIDNKELYEAFCAFGNVSTCKVVVDSHGVSKGFGFIQFEKDEDAQIAIKNLNGVSIKGKQVYVGKFIRQEEWNDAKRSLKLTELAYANLYTKNLDETITDDEKLKALFSEFGTITSCKIMIDSRGVSKGFGF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G095200
TK1151 IDTkA08G095200
OH-1004 IDLXL04_031213
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)98.400
Protein coverage (%)TK1151 99.317 / OH-1004 70.209
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G095200
LocationChr08:24594896-24596698 (+)
DescriptionSimilar to PAB2: Polyadenylate-binding protein 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g49760 Binds the poly(A) tail of mRNA. No verified direct reference in this release
At4g34110 Binds the poly(A) tail of mRNA. No verified direct reference in this release
At2g23350 Binds the poly(A) tail of mRNA. No verified direct reference in this release
At1g71770 Binds the poly(A) tail of mRNA.
Differential organ-specific expression of three poly(A)-binding-protein genes from Arabidopsis thaliana.1993 · DOI: 10.1073/pnas.90.14.6686
A pollen-, ovule-, and early embryo-specific poly(A) binding protein from Arabidopsis complements essential functions in yeast.1996 · DOI: 10.1105/tpc.8.8.1261
At1g22760 Binds the poly(A) tail of mRNA.
Unexpected complexity of poly(A)-binding protein gene families in flowering plants: three conserved lineages that are at least 200 million years old and possible auto- and cross-regulation.2003 · DOI: 10.1093/genetics/163.1.311
Evidence that poly(A) binding protein has an evolutionarily conserved function in facilitating mRNA biogenesis and export.2003 · DOI: 10.1261/rna.5128903

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031213 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process
GO:0006413 translational initiation Biological Process
GO:0006417 regulation of translation Biological Process
GO:0006446 regulation of translational initiation Biological Process
GO:0048255 mRNA stabilization Biological Process
GO:0060211 regulation of nuclear-transcribed mRNA poly(A) tail shortening Biological Process
GO:1900151 regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
KEGG gene cross-reference
ath:AT1G49760
ath:AT4G34110
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.549
Rank 1 · TkA08G095200 · TK1151
Nucleus0.489
Rank 2 · TkA08G095200 · TK1151
Cell membrane0.055
Rank 3 · TkA08G095200 · TK1151
Mitochondrion0.042
Rank 4 · TkA08G095200 · TK1151
Endoplasmic reticulum0.032
Rank 5 · TkA08G095200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13893RRM_531-108 aa
PF00076RRM_133-103 aa
PF16367RRM_733-59 aa
PF16842RRM_occluded33-67 aa
PF22976RRM_1038-103 aa
PF25061RRM_fung43-91 aa
PF26250RRM_RdRP1_248-91 aa
PF29326RRM_MUD2_C71-106 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G095200PF13893RRM_5311081.1e-1042.0
TkA08G095200PF00076RRM_1331032.3e-57191.5
TkA08G095200PF16367RRM_733590.02815.1
TkA08G095200PF16842RRM_occluded33670.0314.9
TkA08G095200PF22976RRM_10381039.6e-0832.8
TkA08G095200PF25061RRM_fung43910.1313.2
TkA08G095200PF26250RRM_RdRP1_248914.6e-0627.7
TkA08G095200PF29326RRM_MUD2_C711063.7e-0524.5
TkA08G095200PF28976RRM_ACIN176920.008816.8
TkA08G095200PF29326RRM_MUD2_C1161253.7e-0524.5
TkA08G095200PF00076RRM_11211892.3e-57191.5
TkA08G095200PF16367RRM_71211760.02815.1
TkA08G095200PF13893RRM_51221911.1e-1042.0
TkA08G095200PF28976RRM_ACIN11221820.008816.8
TkA08G095200PF22976RRM_101251889.6e-0832.8
TkA08G095200PF26250RRM_RdRP1_21341724.6e-0627.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FXA2Arabidopsis thalianasp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 836.300%Swiss-ProtMedium
P42731Arabidopsis thalianasp|P42731|PABP2_ARATH Polyadenylate-binding protein 236.000%Swiss-ProtMedium
O22173Arabidopsis thalianasp|O22173|PABP4_ARATH Polyadenylate-binding protein 435.300%Swiss-ProtMedium
Q05196Arabidopsis thalianasp|Q05196|PABP5_ARATH Polyadenylate-binding protein 534.400%Swiss-ProtMedium
O64380Arabidopsis thalianasp|O64380|PABP3_ARATH Polyadenylate-binding protein 334.800%Swiss-ProtMedium

JBrowse

View in Genome Browser