TkA08G093390 | RubberDandelionOmics

Gene overview

TkA08G093390

Reference: TK1151 Chr: Chr08 Coordinates: 24202261-24206281 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2520 bp · TkA08G093390|TK1151|cDNA

TTTGCAAGAAATTGAAAAAGAAACCCAACATCCAACATTGAGATGTGTTTAGTAGTTCGTCGTTGCATCATCTCATGTGCATGCCCAGTTGTATCGTAATATTCTTTGGAGGTTATATCCATCGTTCGCCAGATCAGAAGACGCAACTGCAACTACTTTGTCATCGCCGCAGTGCAACCTTCGGCGTCTCATTCCGATAAATCTCCAATTTGCAGGTACCGCCTGGCGTGGCGCCTGCACGCAGAATTGTGGTGAAGTAG...

CDS

Download CDS FASTA

1677 bp · TkA08G093390|TK1151|CDS

ATGGCTGATTCACAAGAAAGATGGTGTCTTGTGACCGGTGGAAGAGGCTTTGCAGCAAGACATTTAGTGGAAATGCTCATCCTTTATGATATATATGCAGTCAGAATTGCAGATTTAGGGCCTGAAATCAAGCTACAAACCCATGAGGAAAAGGGCAGTCTTGGAAAAGCATTATCATCAGGTCGTGCCCAATATGTATCCATGGATTTACGCAACAAATCTCAAGTATATAAAGCTTGTGAAGGGGTTGAAGTTGTTTA...

Protein

Download Protein FASTA

558 aa · TkA08G093390|TK1151|PROTEIN

MADSQERWCLVTGGRGFAARHLVEMLILYDIYAVRIADLGPEIKLQTHEEKGSLGKALSSGRAQYVSMDLRNKSQVYKACEGVEVVYHMAAPDSSINNHQLHYSVNVHGTKNIIDACTVQKVKRLIYTSSPSVVFDGIHGVHNGVETMPYPATHNDSYSSTKAEGEALVIKANGINGLLTCCIRPSSIFGPGDKLFVPSLVSAARAGKSKFIIGNGMNMYDFTYVENVAHAHVCAERALASGGTVSKRAAGQAYFITNME...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G093390`
TK1151 ID	TkA08G093390
OH-1004 ID	LXL04_031197
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 99.821 / OH-1004 98.584 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G093390

Location Chr08:24202261-24206281 (+)

Description Similar to 3BETAHSD/D2: 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26260`	3beta-hydroxysteroid-dehydrogenase/decarboxylase involved in sterol synthesis.	Molecular and enzymatic characterizations of novel bifunctional 3beta-hydroxysteroid dehydrogenases/C-4 decarboxylases from Arabidopsis thaliana.2006 · DOI: 10.1074/jbc.m604431200 Overexpression of 3β-hydroxysteroid dehydrogenases/C-4 decarboxylases causes growth defects possibly due to abnormal auxin transport in Arabidopsis.2012 · DOI: 10.1007/s10059-012-0102-6
`At1g47290`	3beta-hydroxysteroid-dehydrogenase/decarboxylase involved in sterol synthesis.	Molecular and enzymatic characterizations of novel bifunctional 3beta-hydroxysteroid dehydrogenases/C-4 decarboxylases from Arabidopsis thaliana.2006 · DOI: 10.1074/jbc.m604431200 Overexpression of 3β-hydroxysteroid dehydrogenases/C-4 decarboxylases causes growth defects possibly due to abnormal auxin transport in Arabidopsis.2012 · DOI: 10.1007/s10059-012-0102-6
`At2g43420`	3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031197 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007224 smoothened signaling pathway Biological Process

GO:0008203 cholesterol metabolic process Biological Process

GO:0016126 sterol biosynthetic process Biological Process

GO:0033489 cholesterol biosynthetic process via desmosterol Biological Process

GO:0033490 cholesterol biosynthetic process via lathosterol Biological Process

GO:0036197 zymosterol biosynthetic process Biological Process

GO:0060918 auxin transport Biological Process

GO:0099402 plant organ development Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005811 lipid droplet Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT1G47290

ath:AT2G26260

ath:AT2G43420

mmu:18194

rno:309262

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.627

Rank 1 · TkA08G093390 · TK1151

Cytoplasm0.135

Rank 2 · TkA08G093390 · TK1151

Golgi apparatus0.114

Rank 3 · TkA08G093390 · TK1151

Cell membrane0.102

Rank 4 · TkA08G093390 · TK1151

Nucleus0.091

Rank 5 · TkA08G093390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF010733Beta_HSD10-284 aa

PF01370Epimerase10-241 aa

PF16363GDP_Man_Dehyd10-234 aa

PF02719Polysacc_synt_210-130 aa

PF05368NmrA10-130 aa

PF07993NAD_binding_411-190 aa

PF13460NAD_binding_1059-134 aa

PF04321RmlD_sub_bind61-282 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G093390	`PF01073`	3Beta_HSD	10	284	1.6e-74	251.2
TkA08G093390	`PF01370`	Epimerase	10	241	7.1e-33	114.7
TkA08G093390	`PF16363`	GDP_Man_Dehyd	10	234	5.8e-18	66.2
TkA08G093390	`PF02719`	Polysacc_synt_2	10	130	1.5e-09	38.2
TkA08G093390	`PF05368`	NmrA	10	130	2.3e-05	24.9
TkA08G093390	`PF07993`	NAD_binding_4	11	190	7.1e-14	52.3
TkA08G093390	`PF13460`	NAD_binding_10	59	134	3.4e-08	34.3
TkA08G093390	`PF04321`	RmlD_sub_bind	61	282	1.6e-10	41.2
TkA08G093390	`PF25127`	DUF7819	280	335	0.17	12.6
TkA08G093390	`PF16363`	GDP_Man_Dehyd	330	351	5.8e-18	66.2
TkA08G093390	`PF02453`	Reticulon	381	536	1.9e-24	87.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67ZE1`	Arabidopsis thaliana	sp\|Q67ZE1\|HSDD2_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 2	64.400%	Swiss-Prot	High
`Q9FX01`	Arabidopsis thaliana	sp\|Q9FX01\|HSDD1_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1	66.300%	Swiss-Prot	High
`A9X4U2`	Arabidopsis thaliana	sp\|A9X4U2\|HSDD3_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 3	38.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card