TkA08G092210 | RubberDandelionOmics

Gene overview

TkA08G092210

Reference: TK1151 Chr: Chr08 Coordinates: 23849177-23854642 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2694 bp · TkA08G092210|TK1151|cDNA

GTGAAGGGTAGTTTGGTCTTCTTGATCCAACTTTCCTCTTCCTCTCCTCCTTATATCCTCGCGTGTCTTCCACCAAATCCGTTGTACTTCAAAAGACGATGAGACTCCACAGTAATATACAGCTACTCTTATGTCTCATACTCACAACACTCGTACTCACCGAGTCAACTCAGCCCCCGTTCGCCTGTGACTCGTCCAAACCCGCCACCAAATCATTCCCATTCTGCAAAACTACACTACCCATCTCCGCCCGTGTCAAA...

CDS

Download CDS FASTA

2325 bp · TkA08G092210|TK1151|CDS

ATGAGACTCCACAGTAATATACAGCTACTCTTATGTCTCATACTCACAACACTCGTACTCACCGAGTCAACTCAGCCCCCGTTCGCCTGTGACTCGTCCAAACCCGCCACCAAATCATTCCCATTCTGCAAAACTACACTACCCATCTCCGCCCGTGTCAAAGACCTCGTCTCCCGCCTCACCCTCGACGAGAAGATCTTGCAGCTCGTGAACACCGCGCCGGCGATACCACGACTCGGTATCCCAGCCTATGAGTGGTG...

Protein

Download Protein FASTA

774 aa · TkA08G092210|TK1151|PROTEIN

MRLHSNIQLLLCLILTTLVLTESTQPPFACDSSKPATKSFPFCKTTLPISARVKDLVSRLTLDEKILQLVNTAPAIPRLGIPAYEWWSEALHGVSNSGYGIRFNGTIKSATSFPQVILTAASFDAQLWYRIGQAIGLEARAVYNEGQANGMTFWAPNINVFRDPRWGRGQETPGEDPLVSGKYAISYVRGVQGDKFEGGGLKDGHLQASACCKHFTAYDLDHWNGVSRFGYDAKVTKQDLADTYQPPFQSCIQRAGASGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G092210`
TK1151 ID	TkA08G092210
OH-1004 ID	LXL04_031181
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.612 / OH-1004 95.539 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G092210

Location Chr08:23849177-23854642 (+)

Description Similar to BXL7: Probable beta-D-xylosidase 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78060`	Probable beta-D-xylosidase 7.	No verified direct reference in this release
`At5g10560`	Probable beta-D-xylosidase 6.	No verified direct reference in this release
`At3g19620`	Probable beta-D-xylosidase 5.	No verified direct reference in this release
`At1g02640`	May be involved in remodeling of xylans during vascular development.	No verified direct reference in this release
`At5g49360`	Involved in pectic arabinan modification in mucilage secretory cells.	AtBXL1, a novel higher plant (Arabidopsis thaliana) putative beta-xylosidase gene, is involved in secondary cell wall metabolism and plant development.2003 · DOI: 10.1046/j.1365-313x.2003.01654.x AtBXL1 encodes a bifunctional beta-D-xylosidase/alpha-L-arabinofuranosidase required for pectic arabinan modification in Arabidopsis mucilage secretory cells.2009 · DOI: 10.1104/pp.109.138388

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031181 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009627 systemic acquired resistance Biological Process

GO:0031222 arabinan catabolic process Biological Process

GO:0045493 xylan catabolic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G02640

ath:AT1G78060

ath:AT3G19620

ath:AT5G10560

ath:AT5G64570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.912

Rank 1 · TkA08G092210 · TK1151

Cytoplasm0.032

Rank 2 · TkA08G092210 · TK1151

Cell membrane0.023

Rank 3 · TkA08G092210 · TK1151

Lysosome / Vacuole0.018

Rank 4 · TkA08G092210 · TK1151

Endoplasmic reticulum0.018

Rank 5 · TkA08G092210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00933Glyco_hydro_3106-356 aa

PF01915Glyco_hydro_3_C402-630 aa

PF14310Fn3-like502-517 aa

PF14310Fn3-like698-766 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G092210	`PF00933`	Glyco_hydro_3	106	356	2.7e-32	113.2
TkA08G092210	`PF01915`	Glyco_hydro_3_C	402	630	1.9e-55	188.7
TkA08G092210	`PF14310`	Fn3-like	502	517	6.9e-08	33.2
TkA08G092210	`PF14310`	Fn3-like	698	766	6.9e-08	33.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGZ5`	Arabidopsis thaliana	sp\|Q9SGZ5\|BXL7_ARATH Probable beta-D-xylosidase 7	65.800%	Swiss-Prot	High
`Q9LXA8`	Arabidopsis thaliana	sp\|Q9LXA8\|BXL6_ARATH Probable beta-D-xylosidase 6	51.100%	Swiss-Prot	High
`Q9LJN4`	Arabidopsis thaliana	sp\|Q9LJN4\|BXL5_ARATH Probable beta-D-xylosidase 5	50.600%	Swiss-Prot	High
`Q94KD8`	Arabidopsis thaliana	sp\|Q94KD8\|BXL2_ARATH Probable beta-D-xylosidase 2	50.700%	Swiss-Prot	High
`Q9FGY1`	Arabidopsis thaliana	sp\|Q9FGY1\|BXL1_ARATH Beta-D-xylosidase 1	50.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card