TkA08G091770 | RubberDandelionOmics

Gene overview

TkA08G091770

Reference: TK1151 Chr: Chr08 Coordinates: 23714000-23714575 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

501 bp · TkA08G091770|TK1151|cDNA

TTTATTTCCAACCGTATAACCGCCGTCCAAGCAGGTCTCGACAGCTGGCAAGCCGAACAAATCAACCGAAAACTCTACTACCTTTCCTTCCTCTCCATCATATTTCTTCCTCTCTCCATCATCACAGGAGTGTTTGGGATGAATGTGGGAGGGGTGCCATGGACGGGACAAAGGGATCCAAAGATAGCGGATGGATTTAGGAACGTGATGTTGGTTTGTGTGGCAACGTTAGCACTTGTGTTGTTATGTTTTTTGTTTCC...

CDS

Download CDS FASTA

477 bp · TkA08G091770|TK1151|CDS

TTTATTTCCAACCGTATAACCGCCGTCCAAGCAGGTCTCGACAGCTGGCAAGCCGAACAAATCAACCGAAAACTCTACTACCTTTCCTTCCTCTCCATCATATTTCTTCCTCTCTCCATCATCACAGGAGTGTTTGGGATGAATGTGGGAGGGGTGCCATGGACGGGACAAAGGGATCCAAAGATAGCGGATGGATTTAGGAACGTGATGTTGGTTTGTGTGGCAACGTTAGCACTTGTGTTGTTATGTTTTTTGTTTCC...

Protein

Download Protein FASTA

158 aa · TkA08G091770|TK1151|PROTEIN

FISNRITAVQAGLDSWQAEQINRKLYYLSFLSIIFLPLSIITGVFGMNVGGVPWTGQRDPKIADGFRNVMLVCVATLALVLLCFLFPFLYSRIAAWRRQRALRKSWSHNRKTFLKERLLEKEGVTFGCEMEGICVYYVFLSKDYYAFLDLFFFIGVIL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G091770`
TK1151 ID	TkA08G091770
OH-1004 ID	LXL04_001477
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.500
Protein coverage (%)	TK1151 77.848 / OH-1004 27.333 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G091770`
Location	Chr08:23714000-23714575 (+)
Description	Similar to zntB: Zinc transport protein ZntB (Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001477` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006824 cobalt ion transport Biological Process GO:0006829 zinc ion transport Biological Process GO:0015675 nickel cation transport Biological Process GO:0005886 plasma membrane Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0005385 zinc ion transmembrane transporter activity Molecular Function GO:0015087 cobalt ion transmembrane transporter activity Molecular Function GO:0015095 magnesium ion transmembrane transporter activity Molecular Function GO:0046873 metal ion transmembrane transporter activity Molecular Function GO:0050897 cobalt ion binding Molecular Function
KEGG gene cross-reference	eca:ECA1993 pae:PA1773 plu:plu2577 yen:YE2107 ypo:BZ17_204 yps:YPTB2257 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.321

Rank 1 · TkA08G091770 · TK1151

Endoplasmic reticulum0.279

Rank 2 · TkA08G091770 · TK1151

Cytoplasm0.217

Rank 3 · TkA08G091770 · TK1151

Cell membrane0.188

Rank 4 · TkA08G091770 · TK1151

Lysosome / Vacuole0.172

Rank 5 · TkA08G091770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01544CorA3-83 aa

PF14110DUF428214-94 aa

PF28902SpoIISA_transm20-37 aa

PF01484Col_cuticle_N30-37 aa

PF15168TRIQK61-89 aa

PF01484Col_cuticle_N72-93 aa

PF28902SpoIISA_transm79-113 aa

PF28902SpoIISA_transm146-153 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G091770	`PF01544`	CorA	3	83	7.3e-15	55.7
TkA08G091770	`PF14110`	DUF4282	14	94	0.0094	17.3
TkA08G091770	`PF28902`	SpoIISA_transm	20	37	3.3	8.6
TkA08G091770	`PF01484`	Col_cuticle_N	30	37	0.14	13.0
TkA08G091770	`PF15168`	TRIQK	61	89	0.0037	17.9
TkA08G091770	`PF01484`	Col_cuticle_N	72	93	0.14	13.0
TkA08G091770	`PF28902`	SpoIISA_transm	79	113	3.3	8.6
TkA08G091770	`PF28902`	SpoIISA_transm	146	153	3.3	8.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card