RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G091350
Reference: TK1151 Chr: Chr08 Coordinates: 23628777-23629461 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

606 bp · TkA08G091350|TK1151|cDNA

ATGAATCATTTTGCATTGGAGAAGGGAGCTAGATGTGGAAAGGTGTACAAAGCAGAATTGACATCAAATGAGATCGTTGCTGTAAATAGAATTCATTCATCTCTAGATGTTGTTGATCGTAATAGCTTTTTACAGGAGGTAAACACATTGACTCAAATAAGGCATCGGAATATTGTAAAGCTATATGGATGTTGTTCAAATTCAAAACACTCTTTCTTGGTTTACGAGTACCTAGCAGGAGGTAGTTTACTTGAAAATTT...

CDS

Download CDS FASTA

606 bp · TkA08G091350|TK1151|CDS

ATGAATCATTTTGCATTGGAGAAGGGAGCTAGATGTGGAAAGGTGTACAAAGCAGAATTGACATCAAATGAGATCGTTGCTGTAAATAGAATTCATTCATCTCTAGATGTTGTTGATCGTAATAGCTTTTTACAGGAGGTAAACACATTGACTCAAATAAGGCATCGGAATATTGTAAAGCTATATGGATGTTGTTCAAATTCAAAACACTCTTTCTTGGTTTACGAGTACCTAGCAGGAGGTAGTTTACTTGAAAATTT...

Protein

Download Protein FASTA

201 aa · TkA08G091350|TK1151|PROTEIN

MNHFALEKGARCGKVYKAELTSNEIVAVNRIHSSLDVVDRNSFLQEVNTLTQIRHRNIVKLYGCCSNSKHSFLVYEYLAGGSLLENLRNKTAKSLSWPKRVNIIKGIADALSYMHHDCSPPIVHRDISSKNILLDFESQACVSDFGTSKILDPNTSNETALAGTYGYLALELAFTMKVTEKCDVYSFGVLVFGSGQRRASK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G091350
TK1151 IDTkA08G091350
OH-1004 IDLXL04_024573
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)84.500
Protein coverage (%)TK1151 93.035 / OH-1004 18.023
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G091350
LocationChr08:23628777-23629461 (-)
DescriptionSimilar to MIK2: MDIS1-interacting receptor like kinase 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g35710 Probable leucine-rich repeat receptor-like protein kinase At1g35710. No verified direct reference in this release
At4g08850 Acts as a receptor of SCOOP peptides from Brassicaceae plants regulating multiple processing including plant growth, development and stress responses.
A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975
Perception of a divergent family of phytocytokines by the Arabidopsis receptor kinase MIK2.2021 · DOI: 10.1038/s41467-021-20932-y
The Arabidopsis MIK2 receptor elicits immunity by sensing a conserved signature from phytocytokines and microbes.2021 · DOI: 10.1038/s41467-021-25580-w
The MIK2/SCOOP Signaling System Contributes to Arabidopsis Resistance Against Herbivory by Modulating Jasmonate and Indole Glucosinolate Biosynthesis.2022 · DOI: 10.3389/fpls.2022.852808
At1g17230 Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230. No verified direct reference in this release
At2g33170 Probable leucine-rich repeat receptor-like protein kinase At2g33170. No verified direct reference in this release
At5g63930 Probable leucine-rich repeat receptor-like protein kinase At5g63930. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_024573 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0002213 defense response to insect Biological Process
GO:0002237 response to molecule of bacterial origin Biological Process
GO:0009695 jasmonic acid biosynthetic process Biological Process
GO:0009755 hormone-mediated signaling pathway Biological Process
GO:0009759 indole glucosinolate biosynthetic process Biological Process
GO:0010183 pollen tube guidance Biological Process
GO:0031349 positive regulation of defense response Biological Process
GO:0080027 response to herbivore Biological Process
GO:1901653 cellular response to peptide Biological Process
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0090406 pollen tube Cellular Component
KEGG gene cross-reference
ath:AT1G17230
ath:AT1G35710
ath:AT4G08850
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.466
Rank 1 · TkA08G091350 · TK1151
Cell membrane0.313
Rank 2 · TkA08G091350 · TK1151
Nucleus0.247
Rank 3 · TkA08G091350 · TK1151
Endoplasmic reticulum0.073
Rank 4 · TkA08G091350 · TK1151
Golgi apparatus0.051
Rank 5 · TkA08G091350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr12-192 aa
PF00069Pkinase12-192 aa
PF03109ABC112-36 aa
PF04628Sedlin_N31-76 aa
PF03881Fructosamin_kin42-81 aa
PF06293Kdo43-147 aa
PF01636APH43-85 aa
PF03109ABC168-158 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G091350PF07714PK_Tyr_Ser-Thr121923.1e-39135.6
TkA08G091350PF00069Pkinase121925.1e-35121.9
TkA08G091350PF03109ABC112362.6e-0524.2
TkA08G091350PF04628Sedlin_N31760.006717.3
TkA08G091350PF03881Fructosamin_kin42810.02714.4
TkA08G091350PF06293Kdo431470.001219.1
TkA08G091350PF01636APH43850.009316.5
TkA08G091350PF03109ABC1681582.6e-0524.2
TkA08G091350PF03881Fructosamin_kin921430.02714.4
TkA08G091350PF17667Pkinase_fungal1021740.001318.2
TkA08G091350PF01636APH1131530.009316.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LP24Arabidopsis thalianasp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g3571058.700%Swiss-ProtHigh
Q8VZG8Arabidopsis thalianasp|Q8VZG8|MIK2_ARATH MDIS1-interacting receptor like kinase 259.200%Swiss-ProtHigh
Q9SHI2Arabidopsis thalianasp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g1723052.400%Swiss-ProtHigh
O49318Arabidopsis thalianasp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g3317047.200%Swiss-ProtMedium
Q9LVP0Arabidopsis thalianasp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g6393048.200%Swiss-ProtMedium

JBrowse

View in Genome Browser