TkA08G090220 | RubberDandelionOmics

Gene overview

TkA08G090220

Reference: TK1151 Chr: Chr08 Coordinates: 23369023-23370584 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1211 bp · TkA08G090220|TK1151|cDNA

TGGTTAACCGTTGTTCAAGAAAAGCTCCTTTTTCTCCACTATTCTCTCTCATCCTCTACTTTTTCCCTCAATAATCTCTCCCCCATTCCCATTCTCTCCCTAAATTCAATTCAAACCCTCACCAGATCTCTCTGATTATCTATTACTCATCGGAAAAATGGCGTTGTCGGCGCGTGACCAAAATGTCTACATGGCCAAGCTCGCGGAGCAGGCGGAACGGTACGATGAAATGGTTGAATTCATGGAGAAAGTCACCGATG...

CDS

Download CDS FASTA

771 bp · TkA08G090220|TK1151|CDS

ATGGCGTTGTCGGCGCGTGACCAAAATGTCTACATGGCCAAGCTCGCGGAGCAGGCGGAACGGTACGATGAAATGGTTGAATTCATGGAGAAAGTCACCGATGAGCTCACAGTCGAAGAACGTAATCTCCTTTCCGTTGCCTACAAGAATGTCATCGGCGCTCGACGTGCTTCCTGGCGTATCATCTCATCGATCGAGCAGAAGGAGGAGTCACGTGGAAATGAGGATCATGTGACTGTGATCAAGGACTACAGATCGAA...

Protein

Download Protein FASTA

256 aa · TkA08G090220|TK1151|PROTEIN

MALSARDQNVYMAKLAEQAERYDEMVEFMEKVTDELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEDHVTVIKDYRSKIEAELSKICDGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGGERKEAAESTLTAYKSAQDIANTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQEDGADEIKEAAPKQSEEQQQQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G090220`
TK1151 ID	TkA08G090220
OH-1004 ID	LXL04_031158
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G090220

Location Chr08:23369023-23370584 (-)

Description Similar to 14-3-3-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78300`	Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031158 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0008104 intracellular protein localization Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0045309 protein phosphorylated amino acid binding Molecular Function

KEGG gene cross-reference

ath:AT1G78300

nta:107777576

sly:101247195

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.706

Rank 1 · TkA08G090220 · TK1151

Nucleus0.370

Rank 2 · TkA08G090220 · TK1151

Cell membrane0.091

Rank 3 · TkA08G090220 · TK1151

Lysosome / Vacuole0.068

Rank 4 · TkA08G090220 · TK1151

Golgi apparatus0.068

Rank 5 · TkA08G090220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13769Virulence_fact5-37 aa

PF0024414-3-312-231 aa

PF16835SF3A230-77 aa

PF13769Virulence_fact58-91 aa

PF13769Virulence_fact196-244 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G090220	`PF13769`	Virulence_fact	5	37	1.9	9.6
TkA08G090220	`PF00244`	14-3-3	12	231	6.6e-106	353.6
TkA08G090220	`PF16835`	SF3A2	30	77	0.19	12.6
TkA08G090220	`PF13769`	Virulence_fact	58	91	1.9	9.6
TkA08G090220	`PF13769`	Virulence_fact	196	244	1.9	9.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q01525`	Arabidopsis thaliana	sp\|Q01525\|14332_ARATH 14-3-3-like protein GF14 omega	88.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card