TkA08G090190 | RubberDandelionOmics

Gene overview

TkA08G090190

Reference: TK1151 Chr: Chr08 Coordinates: 23363832-23366887 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1269 bp · TkA08G090190|TK1151|cDNA

CCAGGACATGTCACTAATAAGATCGCAAAGATAGGACTAGAATTTCCCAAACAAAATATGGATAGGATAAAACCCACGCACACCCATCCACTTGGATTTCACATAATAAACTCAAATTCAAACAGACCAGAGCTAGAAGAAGAAATCAGCAACAATGGGGTTGGTTTCTTTCCTCTCAACAGTCCCAACTTTACTTCCAGTTGCTCCATTACCCACCTACAGTTCCTCCAGATGCCCAGTGCATTCTGAATTGGTGGCAA...

CDS

Download CDS FASTA

1053 bp · TkA08G090190|TK1151|CDS

ATGGGGTTGGTTTCTTTCCTCTCAACAGTCCCAACTTTACTTCCAGTTGCTCCATTACCCACCTACAGTTCCTCCAGATGCCCAGTGCATTCTGGTACCATTAGTTGTAAAATTGACAATGGTGCTAGCCATGAGAATAATGGTGTTCGAAGAAGGGACATTCTTAACTGCTTTGGGGCTGCCGTTAGCATGGAATTGGTGGCAAGCGCGAGTCCAATCCCCAGCCCATTCATCGAGGTAGCAAATGCTGCTGATTTGAT...

Protein

Download Protein FASTA

350 aa · TkA08G090190|TK1151|PROTEIN

MGLVSFLSTVPTLLPVAPLPTYSSSRCPVHSGTISCKIDNGASHENNGVRRRDILNCFGAAVSMELVASASPIPSPFIEVANAADLIQRRQRSDFQSSIKMTLYKAIKANPELISPLLTLALNDSMTYDKPTKTGGPNGSIRFSSEIERPENKGLSGALSMVEEAKKEIDSYSKGGPISYSDLIQLAAQSAVKSTFLASAIRKCGGNEEKGNLLYSAYGSSGQWGLFDKNFGRSDAQEPDPEGRVPDWSTATVQEMKDKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G090190`
TK1151 ID	TkA08G090190
OH-1004 ID	LXL04_031157
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 96.286 / OH-1004 83.005 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G090190

Location Chr08:23363832-23366887 (+)

Description Similar to CLEB3J9: Thylakoid lumenal 29 kDa protein, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g09010`	Thylakoid lumenal 29 kDa protein, chloroplastic.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0223300`	Plays a key role in hydrogen peroxide removal.	No verified direct reference in this release
`UniProt: Q01MI9`	Plays a key role in hydrogen peroxide removal.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031157 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005778 peroxisomal membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

KEGG gene cross-reference

ath:AT4G09010

ath:AT4G35970

dosa:Os04g0223300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.976

Rank 1 · TkA08G090190 · TK1151

Mitochondrion0.025

Rank 2 · TkA08G090190 · TK1151

Nucleus0.018

Rank 3 · TkA08G090190 · TK1151

Cytoplasm0.016

Rank 4 · TkA08G090190 · TK1151

Peroxisome0.013

Rank 5 · TkA08G090190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03485Arg_tRNA_synt_N88-135 aa

PF00141peroxidase101-274 aa

PF20851SidM_Rab1-act260-294 aa

PF00141peroxidase282-303 aa

PF20851SidM_Rab1-act300-347 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G090190	`PF03485`	Arg_tRNA_synt_N	88	135	0.032	15.6
TkA08G090190	`PF00141`	peroxidase	101	274	3.3e-19	70.3
TkA08G090190	`PF20851`	SidM_Rab1-act	260	294	0.16	12.5
TkA08G090190	`PF00141`	peroxidase	282	303	3.3e-19	70.3
TkA08G090190	`PF20851`	SidM_Rab1-act	300	347	0.16	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P82281`	Arabidopsis thaliana	sp\|P82281\|TL29_ARATH Thylakoid lumenal 29 kDa protein, chloroplastic	66.900%	Swiss-Prot	High
`Q0JEQ2`	Oryza sativa subsp. japonica	sp\|Q0JEQ2\|APX3_ORYSJ Probable L-ascorbate peroxidase 3, peroxisomal	32.400%	Swiss-Prot	Medium
`Q01MI9`	Oryza sativa subsp. indica	sp\|Q01MI9\|APX3_ORYSI Probable L-ascorbate peroxidase 3	31.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card