TkA08G087810 | RubberDandelionOmics

Gene overview

TkA08G087810

Reference: TK1151 Chr: Chr08 Coordinates: 22757074-22758636 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1398 bp · TkA08G087810|TK1151|cDNA

GTGGTGGACTCCAATTCCCAAACTTTTGGTTGATGGAAGATTATGGCGTACCGGATGCCGTTAAGGCGGTTCACACCGTCTATTGTGCTGTCAGTTTTCTCAAAAAGCTGCACCCACTCAAAACCCTTTCTGGCGAATCAAATCCCTAATTCGGATCATCAATCCAATTTTAGCCCTGGAATTCCAACCTAACGGTTCCTCTGATTCGTTTATCGACAGCAAACGAATCAGAGAGTAATTCTATGTGCTTTACCTATGAT...

CDS

Download CDS FASTA

579 bp · TkA08G087810|TK1151|CDS

ATGTCTGAATTTCAAGCTGATAATGTGTTCTCGTATCTCCCTGATGATGTAGTTCTTAACATATTATCCAAGCTTGTTGATGATCCGCGTAACTGGTCGTGTCTCGCTTGCGTTTGCACTAAATTTTCATTGCTGATTCGCACGATTTGCTGGAAGAACAAATGCCACCAAATGATCCCCTCCGTCGTCTTCGATTTTCCACCGGAGACTTCCGCCACTTCAACGGTCTCTCCTCCAGGCGGTTGGGCGTCGTTGCACAA...

Protein

Download Protein FASTA

192 aa · TkA08G087810|TK1151|PROTEIN

MSEFQADNVFSYLPDDVVLNILSKLVDDPRNWSCLACVCTKFSLLIRTICWKNKCHQMIPSVVFDFPPETSATSTVSPPGGWASLHKLAVCCPGLMHSGVLLENSDFGLERELGPDENFQEANLFQIDQAEVCAEDTKASAVVKTASDFVVCKRRKMSRSFTSHLASEGWNFSREQGNKLLASRFRGDCLHL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G087810`
TK1151 ID	TkA08G087810
OH-1004 ID	LXL04_018886
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	76.600
Protein coverage (%)	TK1151 100.000 / OH-1004 71.060 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G087810

Location Chr08:22757074-22758636 (-)

Description Similar to EID1: Phytochrome A-associated F-box protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02440`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018886 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009585 red, far-red light phototransduction Biological Process

GO:0010099 regulation of photomorphogenesis Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0048366 leaf development Biological Process

GO:0048573 photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

KEGG gene cross-reference

ath:AT4G02440

ath:AT5G15440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.608

Rank 1 · TkA08G087810 · TK1151

Cytoplasm0.346

Rank 2 · TkA08G087810 · TK1151

Cell membrane0.090

Rank 3 · TkA08G087810 · TK1151

Endoplasmic reticulum0.070

Rank 4 · TkA08G087810 · TK1151

Mitochondrion0.049

Rank 5 · TkA08G087810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29466F-box_COS11110-52 aa

PF12937F-box-like11-56 aa

PF00646F-box11-49 aa

PF27778EID2_C33-45 aa

PF00646F-box85-93 aa

PF27778EID2_C161-191 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G087810	`PF29466`	F-box_COS111	10	52	0.0064	17.8
TkA08G087810	`PF12937`	F-box-like	11	56	2.9e-06	27.7
TkA08G087810	`PF00646`	F-box	11	49	0.16	12.7
TkA08G087810	`PF27778`	EID2_C	33	45	0.00055	20.5
TkA08G087810	`PF00646`	F-box	85	93	0.16	12.7
TkA08G087810	`PF27778`	EID2_C	161	191	0.00055	20.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LEA8`	Arabidopsis thaliana	sp\|Q8LEA8\|EID1_ARATH Phytochrome A-associated F-box protein	47.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card