TkA08G087740 | RubberDandelionOmics

Gene overview

TkA08G087740

Reference: TK1151 Chr: Chr08 Coordinates: 22728427-22728765 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

339 bp · TkA08G087740|TK1151|cDNA

ATGGTAGCAATCTCCGCCATAACGTTATCTTCTTTCACCAGTCCGGCTGCCGGCTCTAGCGGCGGAGATGAGTTTAGCTGGATCTCGAAGCAGGGAGGCGGAGGAGGAGGAGGATGCAGGGGGTCAATCGCCGAGTGTATGGGAGCTGGAGAACTGGAGATGGAATCGGAAAGCACTAGGCGTATATTAGCGACGACTAACTACATAAGCTATGGAGCGCTGCAAGGGAACAATGTTCCGTGCTCGCAGAGAGGTGCGTC...

CDS

Download CDS FASTA

339 bp · TkA08G087740|TK1151|CDS

ATGGTAGCAATCTCCGCCATAACGTTATCTTCTTTCACCAGTCCGGCTGCCGGCTCTAGCGGCGGAGATGAGTTTAGCTGGATCTCGAAGCAGGGAGGCGGAGGAGGAGGAGGATGCAGGGGGTCAATCGCCGAGTGTATGGGAGCTGGAGAACTGGAGATGGAATCGGAAAGCACTAGGCGTATATTAGCGACGACTAACTACATAAGCTATGGAGCGCTGCAAGGGAACAATGTTCCGTGCTCGCAGAGAGGTGCGTC...

Protein

Download Protein FASTA

112 aa · TkA08G087740|TK1151|PROTEIN

MVAISAITLSSFTSPAAGSSGGDEFSWISKQGGGGGGGCRGSIAECMGAGELEMESESTRRILATTNYISYGALQGNNVPCSQRGASYYNCQSGGQANPYQRGCSTITRCQR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G087740`
TK1151 ID	TkA08G087740
OH-1004 ID	LXL04_018881
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 75.000 / OH-1004 68.852 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G087740

Location Chr08:22728427-22728765 (+)

Description Similar to RALF1: Protein RALF-like 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02900`	Cell signaling peptide that may regulate plant stress, growth, and development.	A cytoplasmic Ca2+ functional assay for identifying and purifying endogenous cell signaling peptides in Arabidopsis seedlings: identification of AtRALF1 peptide.2008 · DOI: 10.1021/bi8001488 A conserved dibasic site is essential for correct processing of the peptide hormone AtRALF1 in Arabidopsis thaliana.2008 · DOI: 10.1016/j.febslet.2008.08.025
`At3g05490`	Cell signaling peptide that may regulate plant stress, growth, and development.	No verified direct reference in this release
`At4g15800`	Cell signaling peptide that may regulate plant stress, growth, and development.	No verified direct reference in this release
`At3g16570`	Cell signaling peptide that may regulate plant stress, growth, and development.	Regulation and processing of a plant peptide hormone, AtRALF23, in Arabidopsis.2009 · DOI: 10.1111/j.1365-313x.2009.03926.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018881 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007267 cell-cell signaling Biological Process

GO:0009611 response to wounding Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010469 regulation of signaling receptor activity Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0030308 negative regulation of cell growth Biological Process

GO:0040008 regulation of growth Biological Process

GO:0045926 negative regulation of growth Biological Process

GO:0048364 root development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

KEGG gene cross-reference

ath:AT1G02900

ath:AT3G05490

ath:AT3G16570

ath:AT4G15800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.934

Rank 1 · TkA08G087740 · TK1151

Cell membrane0.033

Rank 2 · TkA08G087740 · TK1151

Endoplasmic reticulum0.033

Rank 3 · TkA08G087740 · TK1151

Cytoplasm0.019

Rank 4 · TkA08G087740 · TK1151

Golgi apparatus0.011

Rank 5 · TkA08G087740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05498RALF51-112 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G087740	`PF05498`	RALF	51	112	1.1e-28	100.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRY3`	Arabidopsis thaliana	sp\|Q9SRY3\|RLF1_ARATH Protein RALF-like 1	74.000%	Swiss-Prot	Medium
`Q9MA62`	Arabidopsis thaliana	sp\|Q9MA62\|RLF22_ARATH Protein RALF-like 22	53.100%	Swiss-Prot	High
`Q8L9P8`	Arabidopsis thaliana	sp\|Q8L9P8\|RLF33_ARATH Protein RALF-like 33	68.800%	Swiss-Prot	Medium
`Q9LUS7`	Arabidopsis thaliana	sp\|Q9LUS7\|RLF23_ARATH Rapid alkalinization factor 23	59.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card