TkA08G087580 | RubberDandelionOmics

Gene overview

TkA08G087580

Reference: TK1151 Chr: Chr08 Coordinates: 22673472-22675471 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1213 bp · TkA08G087580|TK1151|cDNA

CACAATGCCCTTTCAATTAATAAAACCCTACAAACACAACAAAAAACAATCGCCCCGACTTTTTCTTCCTCTGCGATTCTTCCTCGCTGCTTCTTCTGCGTCGCGACCTCCACACAGCCACTGCACTATCTCGGCCGACATCCAGGTTCCGGTGTAATGCATGAAAAATGGGGGCTTGAAAAAAACTAGTTGCGCATCCGGGGAATCGAACCCGGTCAGTACCGTGGGAGGGTACTATGATACCACTACACTAGATGCGC...

CDS

Download CDS FASTA

429 bp · TkA08G087580|TK1151|CDS

ATGAGGATAATTGGATTGACCGGAGGAATTGCAACGGGGAAGAGTACTGTATCTAATCTCTTCAAAGCTAACGGATTTCCTGTCGTCGATGCCGATGTCATCGCCCGTGACGTATTAAAGAAAGGTACTGGTGGTTGGAGAAAGGTAGTTGCAGCTTTTGGGGATGACATACTGCTAGAAAATGGGGAAGTTGATAGGCCAAAATTGGGCCAAATTGTATTCACTGATCCATCAAAACGCCAGCTTCTTAATAGGCTTCT...

Protein

Download Protein FASTA

142 aa · TkA08G087580|TK1151|PROTEIN

MRIIGLTGGIATGKSTVSNLFKANGFPVVDADVIARDVLKKGTGGWRKVVAAFGDDILLENGEVDRPKLGQIVFTDPSKRQLLNRLLSSYISYGILWEVFKLWIKGYKIIILDVPLLFEAKMDTWTTPPLLCILILKHNCND

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G087580`
TK1151 ID	TkA08G087580
OH-1004 ID	LXL04_018877
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 90.141 / OH-1004 55.172 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G087580

Location Chr08:22673472-22675471 (+)

Description Similar to COAE: Dephospho-CoA kinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27490`	Catalyzes the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form coenzyme A.	4'-phosphopantetheine and coenzyme A biosynthesis in plants.2003 · DOI: 10.1074/jbc.m306321200

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0360600`	Catalyzes the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form coenzyme A.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018877 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015937 coenzyme A biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004140 dephospho-CoA kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT2G27490

dosa:Os01g0360600

lin:lin1598

mmu:68087

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.366

Rank 1 · TkA08G087580 · TK1151

Cytoplasm0.234

Rank 2 · TkA08G087580 · TK1151

Mitochondrion0.156

Rank 3 · TkA08G087580 · TK1151

Lysosome / Vacuole0.131

Rank 4 · TkA08G087580 · TK1151

Golgi apparatus0.108

Rank 5 · TkA08G087580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01121CoaE3-127 aa

PF13238AAA_184-42 aa

PF13521AAA_285-53 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G087580	`PF01121`	CoaE	3	127	1.6e-36	126.4
TkA08G087580	`PF13238`	AAA_18	4	42	0.016	16.4
TkA08G087580	`PF13521`	AAA_28	5	53	0.0022	18.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQH0`	Arabidopsis thaliana	sp\|Q9ZQH0\|COAE_ARATH Dephospho-CoA kinase	73.400%	Swiss-Prot	High
`Q94DR2`	Oryza sativa subsp. japonica	sp\|Q94DR2\|COAE_ORYSJ Dephospho-CoA kinase	71.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card