TkA08G083870 | RubberDandelionOmics

Gene overview

TkA08G083870

Reference: TK1151 Chr: Chr08 Coordinates: 21612434-21614283 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

773 bp · TkA08G083870|TK1151|cDNA

TTGGTCGTTAGGGTTTGTAACCTCTCTATCTCGACTACTCAGCGGAACAAAGAGCAAACGCCGCCGTTCGTCGGAGTAGCTGATCCGAGTGAAAAAATGGCGGACACCAAAGCAGTCACAATTCGAACAAGGAAGTTCATGACAAACAGGCTTCTATCCAGGAAACAATTCGTCATTGATGTGCTCCATCCAGGAAGGCCCAATGTCTCCAAGGCTGAACTCAAGGAGAAGTTGGCTAGGATGTATGAGGTGAAAGATCC...

CDS

Download CDS FASTA

507 bp · TkA08G083870|TK1151|CDS

TTGGTCGTTAGGGTTTGTAACCTCTCTATCTCGACTACTCAGCGGAACAAAGAGCAAACGCCGCCGTTCGTCGGAGTAGCTGATCCGAGTGAAAAAATGGCGGACACCAAAGCAGTCACAATTCGAACAAGGAAGTTCATGACAAACAGGCTTCTATCCAGGAAACAATTCGTCATTGATGTGCTCCATCCAGGAAGGCCCAATGTCTCCAAGGCTGAACTCAAGGAGAAGTTGGCTAGGATGTATGAGGTGAAAGATCC...

Protein

Download Protein FASTA

168 aa · TkA08G083870|TK1151|PROTEIN

LVVRVCNLSISTTQRNKEQTPPFVGVADPSEKMADTKAVTIRTRKFMTNRLLSRKQFVIDVLHPGRPNVSKAELKEKLARMYEVKDPNGIFVFKFRTHFGGGKSTGFGLIYDSVENAKKYEPKYRLVRNGLDTKVEKSRKQLKERKNRAKKIRGVKKTKAGDAAKKKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G083870`
TK1151 ID	TkA08G083870
OH-1004 ID	LXL04_018805
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 91.071 / OH-1004 11.478 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G083870

Location Chr08:21612434-21614283 (-)

Description Similar to IDM1: Increased DNA methylation 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g04920`	Small ribosomal subunit protein eS24z.	No verified direct reference in this release
`At5g28060`	Small ribosomal subunit protein eS24y.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018805 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002181 cytoplasmic translation Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006412 translation Biological Process

GO:0080188 gene silencing by siRNA-directed DNA methylation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT3G04920

ath:AT3G14980

ath:AT5G28060

ddi:DDB_G0275473

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.780

Rank 1 · TkA08G083870 · TK1151

Nucleus0.238

Rank 2 · TkA08G083870 · TK1151

Endoplasmic reticulum0.108

Rank 3 · TkA08G083870 · TK1151

Mitochondrion0.052

Rank 4 · TkA08G083870 · TK1151

Cell membrane0.024

Rank 5 · TkA08G083870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01282Ribosomal_S24e39-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G083870	`PF01282`	Ribosomal_S24e	39	130	3.5e-39	133.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SS17`	Arabidopsis thaliana	sp\|Q9SS17\|RS241_ARATH Small ribosomal subunit protein eS24z	92.300%	Swiss-Prot	High
`Q8LC83`	Arabidopsis thaliana	sp\|Q8LC83\|RS242_ARATH Small ribosomal subunit protein eS24y	89.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card