TkA08G082750 | RubberDandelionOmics

Gene overview

TkA08G082750

Reference: TK1151 Chr: Chr08 Coordinates: 21270713-21279764 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3789 bp · TkA08G082750|TK1151|cDNA

GTATCGAAACAAAGACGGAGAATTTGGCAGTTCTTCCGAAATCCAAATCACCGTCCAAGTATCTGTGAACACTTACAGTCGTCGACGTACTCATCTCCGTCGCCGATCTCCATCGTTCTTCTGCTAGATCTCTGCGATCAGATCAATTGCAGAAGCCAAACAATAATTTGATAAGTGTGAGCTATGGTGACTGAAAATCCCAACCACGCAAATAACTATCCAAGACCAGCTGCTACACCATTTGCACCTCCTCAAAGCAA...

CDS

Download CDS FASTA

3192 bp · TkA08G082750|TK1151|CDS

ATGGTGACTGAAAATCCCAACCACGCAAATAACTATCCAAGACCAGCTGCTACACCATTTGCACCTCCTCAAAGCAACACACCTTTTTCATCATCACGTCCTGTGGCTAACTCTGCTTTCAGGCCAACACCTCCCCCAAACACACCTCCATCTTTTCCTTCTGGACCTGTAGTTGGATCAGAAGTTCCTGGTTTTAGACCCATGCAAACTGCTACTAGACCTACTCCACCATATGGCCCACCAACCACCGGACCTTTCCA...

Protein

Download Protein FASTA

1063 aa · TkA08G082750|TK1151|PROTEIN

MVTENPNHANNYPRPAATPFAPPQSNTPFSSSRPVANSAFRPTPPPNTPPSFPSGPVVGSEVPGFRPMQTATRPTPPYGPPTTGPFQRFPTPPFQTPPPPRTAPPVGPPTIRPPAFQNHQPQVPPPSMPMGSPPQTMNGMLSNSNMQQPQPPMGPRPGHPAAVRATSSSAWPGYPGMQSNTATPPPPSGGYAPPQPTTSTPFQGGYAPPQPTTSAPFQGGYAPPQPTTSAQFQGGYAPPQPTTSAQFQGGYAPPQPTTSA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G082750`
TK1151 ID	TkA08G082750
OH-1004 ID	LXL04_018781
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G082750

Location Chr08:21270713-21279764 (+)

Description Similar to At3g07100: Protein transport protein Sec24-like At3g07100

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07100`	Essential protein.	A missense mutation in the Arabidopsis COPII coat protein Sec24A induces the formation of clusters of the endoplasmic reticulum and Golgi apparatus.2009 · DOI: 10.1105/tpc.109.068262 Evidence for the involvement of the Arabidopsis SEC24A in male transmission.2011 · DOI: 10.1093/jxb/err174 Endomembrane trafficking protein SEC24A regulates cell size patterning in Arabidopsis.2014 · DOI: 10.1104/pp.114.246033 The Vesicle-Forming 6K2 Protein of Turnip Mosaic Virus Interacts with the COPII Coatomer Sec24a for Viral Systemic Infection.2015 · DOI: 10.1128/jvi.00503-15

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018781 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0007029 endoplasmic reticulum organization Biological Process

GO:0007030 Golgi organization Biological Process

GO:0008361 regulation of cell size Biological Process

GO:0009555 pollen development Biological Process

GO:0032374 regulation of cholesterol transport Biological Process

GO:0032876 negative regulation of DNA endoreduplication Biological Process

GO:0042632 cholesterol homeostasis Biological Process

GO:0046740 transport of virus in host, cell to cell Biological Process

GO:0048232 male gamete generation Biological Process

GO:0050714 positive regulation of protein secretion Biological Process

KEGG gene cross-reference

ath:AT3G07100

bta:505089

hsa:10427

hsa:10802

mmu:77371

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.621

Rank 1 · TkA08G082750 · TK1151

Golgi apparatus0.247

Rank 2 · TkA08G082750 · TK1151

Nucleus0.148

Rank 3 · TkA08G082750 · TK1151

Endoplasmic reticulum0.114

Rank 4 · TkA08G082750 · TK1151

Lysosome / Vacuole0.108

Rank 5 · TkA08G082750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08033Sec23_BS336-354 aa

PF07754Ribosomal_aS21392-407 aa

PF04810zf-Sec23_Sec24393-431 aa

PF04811Sec23_trunk468-704 aa

PF19088TUTase483-536 aa

PF09631Sen15493-533 aa

PF08033Sec23_BS710-793 aa

PF04811Sec23_trunk790-835 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G082750	`PF08033`	Sec23_BS	336	354	3.1e-25	89.3
TkA08G082750	`PF07754`	Ribosomal_aS21	392	407	0.23	12.0
TkA08G082750	`PF04810`	zf-Sec23_Sec24	393	431	1.8e-17	63.7
TkA08G082750	`PF04811`	Sec23_trunk	468	704	5.6e-84	282.2
TkA08G082750	`PF19088`	TUTase	483	536	0.048	14.1
TkA08G082750	`PF09631`	Sen15	493	533	0.18	12.9
TkA08G082750	`PF08033`	Sec23_BS	710	793	3.1e-25	89.3
TkA08G082750	`PF04811`	Sec23_trunk	790	835	5.6e-84	282.2
TkA08G082750	`PF04815`	Sec23_helical	805	908	3.2e-22	79.0
TkA08G082750	`PF00626`	Gelsolin	940	987	6.1e-06	26.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFU0`	Arabidopsis thaliana	sp\|Q9SFU0\|SC24A_ARATH Protein transport protein SEC24 A	79.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card