TkA08G081940 | RubberDandelionOmics

Gene overview

TkA08G081940

Reference: TK1151 Chr: Chr08 Coordinates: 21051356-21054630 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1920 bp · TkA08G081940|TK1151|cDNA

TCTGACCACACAATGAAAATAAAAATAAATTCTACAGTTTCACTCCCCTTCCCCTATTAACCGATTTCCCTCTTCCATCTCCCTCGCTCTCAATTTCAATCTAATGCAAAGATCCAAAATTTTCTTCCCATTCATCACCTTCTCCTGTAAAATACAAATCCAAATCTCAAAATCTAAACTCAAACATGGAGAAATTTGAAGAATTCGCATGGGAATTGAAAGAATTCCTAACAACAAAAATCTTCCCTTATCTCCATTAT...

CDS

Download CDS FASTA

1638 bp · TkA08G081940|TK1151|CDS

ATGGAGAAATTTGAAGAATTCGCATGGGAATTGAAAGAATTCCTAACAACAAAAATCTTCCCTTATCTCCATTATCTCAACGCTGTTATTAAAACATATCTAGATTACCCTCCCGACAAAGTTAAACCCACATACACCCACATAATCTTCGCAGCTTCAATCGGTTTGATCATTGCTGGCACAATGCACATTCGTCTCAGAAAAGTCCGAACTCACAAGATCATTCCATGGATTCGTGTCTCAAAGAACCGCAGGCCGTT...

Protein

Download Protein FASTA

545 aa · TkA08G081940|TK1151|PROTEIN

MEKFEEFAWELKEFLTTKIFPYLHYLNAVIKTYLDYPPDKVKPTYTHIIFAASIGLIIAGTMHIRLRKVRTHKIIPWIRVSKNRRPLKLERFPHYVARQMGFDDEGLCPYLCKLASDYIRKEEGCEEDMYSFFGDDPNADTLFIKLVEEFERCILSYFAFHWSHASYMISQVLGPDTHEPKKKLKNIVMQATREQRFERVTKNLKVARVFTTLVEEMKAIGLVAVDDSQCTDVMVPMAHKDRSPLLLFMGGGMGAGKSTV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G081940`
TK1151 ID	TkA08G081940
OH-1004 ID	LXL04_018763
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G081940

Location Chr08:21051356-21054630 (+)

Description Similar to NADKC: Calmodulin calcium-dependent NAD kinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04280`	May phosphorylate NAD⁺ to NADP⁺ in a calcium/calmodulin-dependent manner.	Identification of the Arabidopsis Calmodulin-Dependent NAD + Kinase That Sustains the Elicitor-Induced Oxidative Burst.2019 · DOI: 10.1104/pp.19.00912

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018763 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006741 NADP+ biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0003951 NAD+ kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G04280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.412

Rank 1 · TkA08G081940 · TK1151

Endoplasmic reticulum0.231

Rank 2 · TkA08G081940 · TK1151

Cytoplasm0.199

Rank 3 · TkA08G081940 · TK1151

Nucleus0.164

Rank 4 · TkA08G081940 · TK1151

Cell membrane0.099

Rank 5 · TkA08G081940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13238AAA_18149-202 aa

PF03215Rad17149-215 aa

PF06414Zeta_toxin239-344 aa

PF03215Rad17240-289 aa

PF13671AAA_33246-354 aa

PF13238AAA_18250-340 aa

PF06414Zeta_toxin393-444 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G081940	`PF13238`	AAA_18	149	202	0.00064	20.9
TkA08G081940	`PF03215`	Rad17	149	215	0.16	12.6
TkA08G081940	`PF06414`	Zeta_toxin	239	344	3.4e-16	60.0
TkA08G081940	`PF03215`	Rad17	240	289	0.16	12.6
TkA08G081940	`PF13671`	AAA_33	246	354	1.1e-05	26.5
TkA08G081940	`PF13238`	AAA_18	250	340	0.00064	20.9
TkA08G081940	`PF06414`	Zeta_toxin	393	444	3.4e-16	60.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WUY1`	Arabidopsis thaliana	sp\|Q0WUY1\|NADKC_ARATH Calmodulin calcium-dependent NAD kinase	58.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card