TkA08G081920 | RubberDandelionOmics

Gene overview

TkA08G081920

Reference: TK1151 Chr: Chr08 Coordinates: 21036518-21045599 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

723 bp · TkA08G081920|TK1151|cDNA

ACGCAATCGGACAAAAGTAAAAAAAAGGTTGAACTTTTGAAATGTTTTTTGGGTATTTCTGTCGGCTGTAGCTGTTCGCCAAAGACTAACGAAGAAGATTCTTTGGAGTTTTGTTATCGTGATTCTCATTTGTTTGGCATTATTCTACATTCATACCTTATTTGGTGGAGCTCATTGTCCAATTCCACTACAATGAAACAAGGTAACATTGGAAATTATTTTAAAAGAAAAGTAGATGTTGGTACTAGTGATGAACATGG...

CDS

Download CDS FASTA

723 bp · TkA08G081920|TK1151|CDS

ACGCAATCGGACAAAAGTAAAAAAAAGGTTGAACTTTTGAAATGTTTTTTGGGTATTTCTGTCGGCTGTAGCTGTTCGCCAAAGACTAACGAAGAAGATTCTTTGGAGTTTTGTTATCGTGATTCTCATTTGTTTGGCATTATTCTACATTCATACCTTATTTGGTGGAGCTCATTGTCCAATTCCACTACAATGAAACAAGGTAACATTGGAAATTATTTTAAAAGAAAAGTAGATGTTGGTACTAGTGATGAACATGG...

Protein

Download Protein FASTA

240 aa · TkA08G081920|TK1151|PROTEIN

TQSDKSKKKVELLKCFLGISVGCSCSPKTNEEDSLEFCYRDSHLFGIILHSYLIWWSSLSNSTTMKQGNIGNYFKRKVDVGTSDEHGGEPQQQPQPQPQSTPTTFGIHNLPYDPSNRPRITTYHPNEAEEIRREYWIEGLCQPKEHLFPITKIGKKNRRFVKDWFDEFNWLEYTKKKDKAYCLCCYLFGDNVGQKGVRDVFVTVDFNSWSKKGAFNAHVGEIHSYHNKAKQKCENLVVKN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G081920`
TK1151 ID	TkA08G081920
OH-1004 ID	LXL04_035619
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	64.000
Protein coverage (%)	TK1151 69.583 / OH-1004 19.099 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G081920`
Location	Chr08:21036518-21045599 (-)
Description	Similar to CDT1A: CDT1-like protein a, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035619` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000076 DNA replication checkpoint signaling Biological Process GO:0000278 mitotic cell cycle Biological Process GO:0006260 DNA replication Biological Process GO:0009658 chloroplast organization Biological Process GO:0030174 regulation of DNA-templated DNA replication initiation Biological Process GO:0048229 gametophyte development Biological Process GO:0051276 chromosome organization Biological Process GO:0071163 DNA replication preinitiation complex assembly Biological Process GO:0005634 nucleus Cellular Component GO:0009507 chloroplast Cellular Component GO:0003677 DNA binding Molecular Function GO:0004693 cyclin-dependent protein serine/threonine kinase activity Molecular Function
KEGG gene cross-reference	ath:AT2G31270 ath:AT3G54710 hsa:79830 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.596

Rank 1 · TkA08G081920 · TK1151

Cytoplasm0.385

Rank 2 · TkA08G081920 · TK1151

Mitochondrion0.052

Rank 3 · TkA08G081920 · TK1151

Endoplasmic reticulum0.041

Rank 4 · TkA08G081920 · TK1151

Cell membrane0.039

Rank 5 · TkA08G081920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27146Y4jL_N149-177 aa

PF14291DUF4371199-237 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G081920	`PF27146`	Y4jL_N	149	177	0.076	13.6
TkA08G081920	`PF14291`	DUF4371	199	237	4.9e-07	30.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card