TkA08G080880 | RubberDandelionOmics

Gene overview

TkA08G080880

Reference: TK1151 Chr: Chr08 Coordinates: 20789324-20801693 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1503 bp · TkA08G080880|TK1151|cDNA

CCACTATATAGTTTGCAATTGCATTAGCACCGGAGTGCTGTACTGCTGCCGGACGACTGAGAGTTTCATGTGACGATTCCAACGAGGTGAACCGCCGATCGATTTCCCTCCACATCTCAAACTCCTTTTACAGTGACTAGAGATGAAGGAGCTGAAAGATTCAAAGTGGTTCGATGTGGAGTATCTACCAAAGGAATACATATTCTCGAAGGAATACAGACCCGGGAATCTCGATTCCCCTGTTTGTGATTCCATTCCAG...

CDS

Download CDS FASTA

993 bp · TkA08G080880|TK1151|CDS

ATGAAGGAGCTGAAAGATTCAAAGTGGTTCGATGTGGAGTATCTACCAAAGGAATACATATTCTCGAAGGAATACAGACCCGGGAATCTCGATTCCCCTGTTTGTGATTCCATTCCAGTTATAGATCTTTCAAAAGTAAACGGACATGTCAATTCCGTCGAAGCAATCGTGAAGGCTTCTAAAGAATTCGGTTTCTTTCAGGTGATTAATCACGGGATTCCGGAGAAGAAAGTGAATGACGCCATGAACGTTCTTAAGGA...

Protein

Download Protein FASTA

330 aa · TkA08G080880|TK1151|PROTEIN

MKELKDSKWFDVEYLPKEYIFSKEYRPGNLDSPVCDSIPVIDLSKVNGHVNSVEAIVKASKEFGFFQVINHGIPEKKVNDAMNVLKEFFNMSSKETHTKGWIYTNSTDYAKDGVHLWRENLKHPCHPIEDCIHLWPDNPTRYQEVISAYLVEIQKLSLRILELISEGLGLKSGYFKDMSEVQLLSSNIYPPCPDPSLTLGILPHQDPSLITLLYQGQSNGLQVMKDGQWINVGAIPNAFVVNIGNQLEIISNEKLKSVKH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G080880`
TK1151 ID	TkA08G080880
OH-1004 ID	LXL04_018750
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G080880

Location Chr08:20789324-20801693 (-)

Description Similar to H6H: Hyoscyamine 6-dioxygenase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10500`	Converts salicylic acid (SA) to both 2,3-dihydroxybenzoic acid (2,3-DHBA) and 2,5-DHBA in vitro but only 2,3-DHBA in vivo.	DOWNY MILDEW RESISTANT 6 and DMR6-LIKE OXYGENASE 1 are partially redundant but distinct suppressors of immunity in Arabidopsis.2015 · DOI: 10.1111/tpj.12719
`At4g10490`	Converts salicylic acid (SA) to 2,3-dihydroxybenzoic acid (2,3-DHBA) (By similarity).	DOWNY MILDEW RESISTANT 6 and DMR6-LIKE OXYGENASE 1 are partially redundant but distinct suppressors of immunity in Arabidopsis.2015 · DOI: 10.1111/tpj.12719
`At5g24530`	Converts salicylic acid (SA) to 2,3-dihydroxybenzoic acid (2,3-DHBA) (By similarity).	Identification of arabidopsis loci required for susceptibility to the downy mildew pathogen Hyaloperonospora parasitica.2005 · DOI: 10.1094/mpmi-18-0583 Arabidopsis DMR6 encodes a putative 2OG-Fe(II) oxygenase that is defense-associated but required for susceptibility to downy mildew.2008 · DOI: 10.1111/j.1365-313x.2008.03427.x DOWNY MILDEW RESISTANT 6 and DMR6-LIKE OXYGENASE 1 are partially redundant but distinct suppressors of immunity in Arabidopsis.2015 · DOI: 10.1111/tpj.12719

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018750 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0002238 response to molecule of fungal origin Biological Process

GO:0002239 response to oomycetes Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009805 coumarin biosynthetic process Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0010150 leaf senescence Biological Process

GO:0046244 salicylic acid catabolic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0016706 2-oxoglutarate-dependent dioxygenase activity Molecular Function

KEGG gene cross-reference

ag:BAA05630

ag:BAA78340

ath:AT4G10490

ath:AT4G10500

dosa:Os10g0536400

osa:4349238

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.827

Rank 1 · TkA08G080880 · TK1151

Nucleus0.296

Rank 2 · TkA08G080880 · TK1151

Endoplasmic reticulum0.046

Rank 3 · TkA08G080880 · TK1151

Mitochondrion0.044

Rank 4 · TkA08G080880 · TK1151

Cell membrane0.043

Rank 5 · TkA08G080880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF031712OG-FeII_Oxy5-21 aa

PF14226DIOX_N38-138 aa

PF031712OG-FeII_Oxy183-279 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G080880	`PF03171`	2OG-FeII_Oxy	5	21	7.9e-33	113.5
TkA08G080880	`PF14226`	DIOX_N	38	138	7.3e-16	59.6
TkA08G080880	`PF03171`	2OG-FeII_Oxy	183	279	7.9e-33	113.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZSA8`	Arabidopsis thaliana	sp\|Q9ZSA8\|DLO1_ARATH Protein DMR6-LIKE OXYGENASE 1	42.600%	Swiss-Prot	Medium
`Q9ZSA7`	Arabidopsis thaliana	sp\|Q9ZSA7\|DLO2_ARATH Protein DMR6-LIKE OXYGENASE 2	39.900%	Swiss-Prot	Medium
`Q9FLV0`	Arabidopsis thaliana	sp\|Q9FLV0\|DMR6_ARATH Protein DOWNY MILDEW RESISTANCE 6	39.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card