TkA08G080780 | RubberDandelionOmics

Gene overview

TkA08G080780

Reference: TK1151 Chr: Chr08 Coordinates: 20757037-20760563 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3094 bp · TkA08G080780|TK1151|cDNA

ATACAACGTATTTTGTTGTTTACACTTTACATTTTTAAAAAAAGAAAGGAGCCAAAAATATGGGGATGCGGAAACTAGTTGCTGTAAAAGTTAAAGGGTCCCAAAGTTAAACCCACAGTACGTAGGAAAAGTTGGTAAAGTGGCGTTGAGTTAACGCACCGCTCTCAACGATCAATTCGAACCGGATTCCCACCTTCCTTCCTGAATCGACGAATCCATTTTCGTCTTCACTACCTTCTCATTTAGTACATCTTCTTCAT...

CDS

Download CDS FASTA

444 bp · TkA08G080780|TK1151|CDS

ATGTCGTTCAGATTCTTCCGAGGAGGGCCTAATGCTTCTTCTGGGATGGGTATATCGGAACACTGTAAGGCCACATTCCTGGAACTACAAAGAAAAAAAGCTCACCGTTATCTAGTTTTTAAGATCGACGAAGAGAATAACGAAGTTGTTGTTGAGAAAACCGGCACTCCTGCCGAGAATTACGAAGATTTCACGTCATCTATGCCGGAAAACGACTGCAGATATGCCGTCTACGATTTCGACTTTGTGACTTCCGACAA...

Protein

Download Protein FASTA

147 aa · TkA08G080780|TK1151|PROTEIN

MSFRFFRGGPNASSGMGISEHCKATFLELQRKKAHRYLVFKIDEENNEVVVEKTGTPAENYEDFTSSMPENDCRYAVYDFDFVTSDNCQKSKIFFLSWSPESSRIRAKMLYATSKSSFRQNLDGVHYEIQATDFTEMELDVLKERVH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G080780`
TK1151 ID	TkA08G080780
OH-1004 ID	LXL04_036874
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	79.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G080780

Location Chr08:20757037-20760563 (+)

Description Similar to ADF6: Actin-depolymerizing factor 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g31200`	Actin-depolymerizing protein.	Molecular identification and characterization of the Arabidopsis AtADF1, AtADFS and AtADF6 genes.2001 · DOI: 10.1023/a:1010687911374

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0628100`	Actin-depolymerizing protein.	No verified direct reference in this release
`Os03g0780400`	Actin-depolymerizing protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036874 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0030042 actin filament depolymerization Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0015629 actin cytoskeleton Cellular Component

GO:0003779 actin binding Molecular Function

GO:0051015 actin filament binding Molecular Function

KEGG gene cross-reference

ath:AT1G01750

ath:AT2G31200

dosa:Os03g0780400

dosa:Os12g0628100

vvi:100232871

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.805

Rank 1 · TkA08G080780 · TK1151

Nucleus0.272

Rank 2 · TkA08G080780 · TK1151

Cell membrane0.088

Rank 3 · TkA08G080780 · TK1151

Golgi apparatus0.045

Rank 4 · TkA08G080780 · TK1151

Mitochondrion0.043

Rank 5 · TkA08G080780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00241Cofilin_ADF15-147 aa

PF03090Replicase20-81 aa

PF12012DUF350436-120 aa

PF10857DUF2701103-127 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G080780	`PF00241`	Cofilin_ADF	15	147	9.5e-42	142.5
TkA08G080780	`PF03090`	Replicase	20	81	0.091	13.4
TkA08G080780	`PF12012`	DUF3504	36	120	0.25	12.0
TkA08G080780	`PF10857`	DUF2701	103	127	0.05	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZSK2`	Arabidopsis thaliana	sp\|Q9ZSK2\|ADF6_ARATH Actin-depolymerizing factor 6	67.300%	Swiss-Prot	High
`Q2QLT8`	Oryza sativa subsp. japonica	sp\|Q2QLT8\|ADF11_ORYSJ Actin-depolymerizing factor 11	67.100%	Swiss-Prot	High
`Q9AY76`	Oryza sativa subsp. japonica	sp\|Q9AY76\|ADF2_ORYSJ Actin-depolymerizing factor 2	65.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card