TkA08G080240 | RubberDandelionOmics

Gene overview

TkA08G080240

Reference: TK1151 Chr: Chr08 Coordinates: 20600630-20605521 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2382 bp · TkA08G080240|TK1151|cDNA

AAGTAGTCCGGGCGACGACTCAGAACTCGCACACTCCACTGTTATCGCATGCTCGAACGCTCTTGAGTACCTCTATCTCTTCGACGGCCGATCAAATTCGCAATGGAGAGAAATTTGGGATTTATTTTTGTACTACTAGCTGTAACGTCGATCTGTGAAGCAGTGGCTGTATTTCATCCGATCTCTGAATCTCACAGGTCCGCAGCATTAGAACTGTTATCCCCCGCCGCTGGATCGTTTTCGAGCTTAGAAGAAGCCTA...

CDS

Download CDS FASTA

2052 bp · TkA08G080240|TK1151|CDS

ATGGAGAGAAATTTGGGATTTATTTTTGTACTACTAGCTGTAACGTCGATCTGTGAAGCAGTGGCTGTATTTCATCCGATCTCTGAATCTCACAGGTCCGCAGCATTAGAACTGTTATCCCCCGCCGCTGGATCGTTTTCGAGCTTAGAAGAAGCCTATGAAGCATTAACCACATTCAAGGTCCTTGGTATAGAGAAACCTGAAATAAAGGACCACACATGTAGATCTGTGGTGGATACCTTGTCTTCACCATCTTCAAA...

Protein

Download Protein FASTA

683 aa · TkA08G080240|TK1151|PROTEIN

MERNLGFIFVLLAVTSICEAVAVFHPISESHRSAALELLSPAAGSFSSLEEAYEALTTFKVLGIEKPEIKDHTCRSVVDTLSSPSSNSKDLHNALRVNGILKCKTSQEALTGIVSRLKDAVKDATTLLDYHHSIGGLVLIKDQNHGVDVLLENADGILRSIKALSQSDGRWRHSSNNPESSTYAAGVALETLSGVISLSASPIDENLIATLKKDTVKLFDSISKYDDGAYYFDDKLIDASSPLSATSAVVRGVTAFASAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G080240`
TK1151 ID	TkA08G080240
OH-1004 ID	LXL04_038652
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	53.700
Protein coverage (%)	TK1151 9.810 / OH-1004 8.492 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G080240

Location Chr08:20600630-20605521 (+)

Description Similar to LIMYB: L10-interacting MYB domain-containing protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21150`	Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0911200`	Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038652 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific Molecular Function

GO:0004518 nuclease activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G05800

bta:514442

rno:690164

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.875

Rank 1 · TkA08G080240 · TK1151

Cytoplasm0.106

Rank 2 · TkA08G080240 · TK1151

Nucleus0.080

Rank 3 · TkA08G080240 · TK1151

Golgi apparatus0.060

Rank 4 · TkA08G080240 · TK1151

Cell membrane0.037

Rank 5 · TkA08G080240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05817Ribophorin_II27-300 aa

PF23861Ribophorin_II_2nd308-413 aa

PF23860Ribophorin_II_3rd421-542 aa

PF23861Ribophorin_II_2nd515-524 aa

PF25147Ribophorin_II_C575-675 aa

PF06170DUF983610-663 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G080240	`PF05817`	Ribophorin_II	27	300	2.8e-49	168.7
TkA08G080240	`PF23861`	Ribophorin_II_2nd	308	413	7.3e-20	71.8
TkA08G080240	`PF23860`	Ribophorin_II_3rd	421	542	2.8e-34	118.6
TkA08G080240	`PF23861`	Ribophorin_II_2nd	515	524	7.3e-20	71.8
TkA08G080240	`PF25147`	Ribophorin_II_C	575	675	2.3e-25	89.8
TkA08G080240	`PF06170`	DUF983	610	663	0.34	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Z16`	Arabidopsis thaliana	sp\|Q93Z16\|RPN2_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2	59.800%	Swiss-Prot	High
`Q5N7W3`	Oryza sativa subsp. japonica	sp\|Q5N7W3\|RPN2_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2	54.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card