TkA08G080160 | RubberDandelionOmics

Gene overview

TkA08G080160

Reference: TK1151 Chr: Chr08 Coordinates: 20572763-20573773 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

627 bp · TkA08G080160|TK1151|cDNA

ATGTTCCTCTGTGAAGATGAACACAATAGACCCAGACCTGATTCTATGCAACAAAGTGAAAATGCGTATTTGACTACTTCAAAATTTGACTCGTATGACGAATTAGTCAAGAGTGTTCGAGAATTCTATTATACAAAAGGTTATGGAATATCTATTCGTGGTTCAAACCCAGACAAATATGTGATTTTGCAATGTGACAGAGGTGGTTCGTACCGAGATATACGAGGTATCTCGGGTAAACGAAAGAAATCTACCAGCAC...

CDS

Download CDS FASTA

627 bp · TkA08G080160|TK1151|CDS

ATGTTCCTCTGTGAAGATGAACACAATAGACCCAGACCTGATTCTATGCAACAAAGTGAAAATGCGTATTTGACTACTTCAAAATTTGACTCGTATGACGAATTAGTCAAGAGTGTTCGAGAATTCTATTATACAAAAGGTTATGGAATATCTATTCGTGGTTCAAACCCAGACAAATATGTGATTTTGCAATGTGACAGAGGTGGTTCGTACCGAGATATACGAGGTATCTCGGGTAAACGAAAGAAATCTACCAGCAC...

Protein

Download Protein FASTA

208 aa · TkA08G080160|TK1151|PROTEIN

MFLCEDEHNRPRPDSMQQSENAYLTTSKFDSYDELVKSVREFYYTKGYGISIRGSNPDKYVILQCDRGGSYRDIRGISGKRKKSTSTRLINCPFQIVGKKQGDDGAWMITIKDLTHNHEPSEDISGHPSFRQLSSESVKTVEEMTKAGIPPRQILSSLRQQTPNLPAISRTIYNVKKKIRIQSLSSQRRTFIDLNAYPFDTCDLDGPF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G080160`
TK1151 ID	TkA08G080160
OH-1004 ID	LXL04_018733
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G080160`
Location	Chr08:20572763-20573773 (-)
Description	Similar to CHGG_01239: PKS-NRPS hybrid synthetase CHGG_01239 (Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018733` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006633 fatty acid biosynthetic process Biological Process GO:0009403 toxin biosynthetic process Biological Process GO:0032259 methylation Biological Process GO:0004312 fatty acid synthase activity Molecular Function GO:0004315 3-oxoacyl-[acyl-carrier-protein] synthase activity Molecular Function GO:0008168 methyltransferase activity Molecular Function GO:0016491 oxidoreductase activity Molecular Function GO:0016853 isomerase activity Molecular Function GO:0016874 ligase activity Molecular Function GO:0031177 phosphopantetheine binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.953

Rank 1 · TkA08G080160 · TK1151

Cytoplasm0.158

Rank 2 · TkA08G080160 · TK1151

Mitochondrion0.018

Rank 3 · TkA08G080160 · TK1151

Cell membrane0.011

Rank 4 · TkA08G080160 · TK1151

Extracellular0.008

Rank 5 · TkA08G080160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08731AFT30-119 aa

PF03101FAR163-119 aa

PF08731AFT170-178 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G080160	`PF08731`	AFT	30	119	1.8e-05	25.7
TkA08G080160	`PF03101`	FAR1	63	119	0.0051	18.2
TkA08G080160	`PF08731`	AFT	170	178	1.8e-05	25.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card