TkA08G079920 | RubberDandelionOmics

Gene overview

TkA08G079920

Reference: TK1151 Chr: Chr08 Coordinates: 20515145-20516999 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1113 bp · TkA08G079920|TK1151|cDNA

ATGGAAAGATATCTTGTATCAGGAATATTGACAGATGGCAACTCTACATTGGCTGAATATTGCTTACTCACCAACAGTGGTAGAAAGTTCATGTCACTTCTACAAACTGTTATCGAAGATGTTTCTTCTTTGGTTTCTATTTTGGGAAGTACAATTCTTGAAGAACTCATGGACTTTTTCACAGATTACACTTTCATCCTTCAAACAGCAATCACCCAAGAACCAAACAATGGTGTAGAAGTTACACCAAAATTCAAAAA...

CDS

Download CDS FASTA

1113 bp · TkA08G079920|TK1151|CDS

ATGGAAAGATATCTTGTATCAGGAATATTGACAGATGGCAACTCTACATTGGCTGAATATTGCTTACTCACCAACAGTGGTAGAAAGTTCATGTCACTTCTACAAACTGTTATCGAAGATGTTTCTTCTTTGGTTTCTATTTTGGGAAGTACAATTCTTGAAGAACTCATGGACTTTTTCACAGATTACACTTTCATCCTTCAAACAGCAATCACCCAAGAACCAAACAATGGTGTAGAAGTTACACCAAAATTCAAAAA...

Protein

Download Protein FASTA

370 aa · TkA08G079920|TK1151|PROTEIN

MERYLVSGILTDGNSTLAEYCLLTNSGRKFMSLLQTVIEDVSSLVSILGSTILEELMDFFTDYTFILQTAITQEPNNGVEVTPKFKKPESLSQKVSIFANLTTLEQFFFIVIKNLFKNTKDLDSVIEEHMISFTGTLSKMRTQFCNQFIHDIMSNEDSCIEEHGEDLMPSVPYKMLFLELRKVEELAEENIDEFDWLVRLVIEIIETTFHWNSRNLEMFMSKKDSSDHQSDNKLTQFLVDMQFVVEIARHGGYLTTKMIN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G079920`
TK1151 ID	TkA08G079920
OH-1004 ID	LXL04_018720
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.297 / OH-1004 44.776 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G079920`
Location	Chr08:20515145-20516999 (-)
Description	Similar to EXO84B: Exocyst complex component EXO84B
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018720` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006887 exocytosis Biological Process GO:0006893 Golgi to plasma membrane transport Biological Process GO:0008104 intracellular protein localization Biological Process GO:0015031 protein transport Biological Process GO:0060321 acceptance of pollen Biological Process GO:0000145 exocyst Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005773 vacuole Cellular Component GO:0005776 autophagosome Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference	ath:AT1G10180 ath:AT1G10385 ath:AT5G49830 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.457

Rank 1 · TkA08G079920 · TK1151

Nucleus0.455

Rank 2 · TkA08G079920 · TK1151

Lysosome / Vacuole0.076

Rank 3 · TkA08G079920 · TK1151

Cell membrane0.068

Rank 4 · TkA08G079920 · TK1151

Golgi apparatus0.067

Rank 5 · TkA08G079920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27696EXO84_helical6-129 aa

PF24983DUF7774105-141 aa

PF24983DUF7774201-242 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G079920	`PF27696`	EXO84_helical	6	129	2.8e-29	102.8
TkA08G079920	`PF24983`	DUF7774	105	141	0.049	14.4
TkA08G079920	`PF24983`	DUF7774	201	242	0.049	14.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card