TkA08G077940 | RubberDandelionOmics

Gene overview

TkA08G077940

Reference: TK1151 Chr: Chr08 Coordinates: 19985460-19990383 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2657 bp · TkA08G077940|TK1151|cDNA

GAAAAATGTCTTCACGAAAACTTGTGAGCGTGGAAAAAACAAGTTTGAAACATGCCTTGTATTTTTAGGGTTTAGCAGGAAAGGGGGTTTATGAGAAAAAAAAAAGTCCATATCATAACAAAGCCATCATTCACAGAGGTTTTTCAAAGATTTCTTTACCACCTCTTTCCCTGTGAATTGCGTTGCTTTAGGTACCATACATGCAGCCAGATGCAGCGTCTCTCTGAAATGATTCTAAGCTCGCAATCGGCTTCGAATTT...

CDS

Download CDS FASTA

2208 bp · TkA08G077940|TK1151|CDS

ATGGTGATGCGATCAGCAGGTAGATGGTATCATATATTAAGGAACTATCAATCATCCAAACGAGTACTTAACTCAGTTACTCTATATTCATGCCGGAAAATCAATAATGGTGGATTAATACATAAACAACATACTCATAGGTTTTCATCTGTATCAGAATCATGTAAAAATTCTCCTTCAGAGGCCCTTTTATTATCAACCTTCATCAGATCTAGTCTTAACGAGCTCAAAGGCCCCTCTCATTGTTGGTTAAATAGAAA...

Protein

Download Protein FASTA

735 aa · TkA08G077940|TK1151|PROTEIN

MVMRSAGRWYHILRNYQSSKRVLNSVTLYSCRKINNGGLIHKQHTHRFSSVSESCKNSPSEALLLSTFIRSSLNELKGPSHCWLNRNPTTKDLTSKNGVFLVIAGAFLELGHSSTSMFEKVKSLQQRHPSLKVMGFQHCKEVNNDIIRSHLSKLIMSEYITFPILLSNKSFSEKSDKKGYIIFNGMEGPPLLHDNDVNFEILETAIKDLIMMQQKEKPGLLHNLRGTWVKPLDALKEPYLCSPLQNLLLYFPGCIEVDEY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G077940`
TK1151 ID	TkA08G077940
OH-1004 ID	LXL04_018684
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G077940`
Location	Chr08:19985460-19990383 (-)
Description	Similar to SOQ1: Protein SUPPRESSOR OF QUENCHING 1, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018684` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0010196 nonphotochemical quenching Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0009534 chloroplast thylakoid Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0042651 thylakoid membrane Cellular Component GO:0016787 hydrolase activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	ath:AT1G56500 bta:534327 gga:423903 hsa:374354 mmu:66866 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.402

Rank 1 · TkA08G077940 · TK1151

Plastid0.175

Rank 2 · TkA08G077940 · TK1151

Cytoplasm0.165

Rank 3 · TkA08G077940 · TK1151

Nucleus0.131

Rank 4 · TkA08G077940 · TK1151

Endoplasmic reticulum0.109

Rank 5 · TkA08G077940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01436NHL249-277 aa

PF17170DUF5128257-289 aa

PF08450SGL257-285 aa

PF08450SGL308-340 aa

PF01436NHL321-329 aa

PF27455YomR_C421-495 aa

PF08450SGL462-492 aa

PF01436NHL469-483 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G077940	`PF01436`	NHL	249	277	0.00077	20.1
TkA08G077940	`PF17170`	DUF5128	257	289	0.053	13.4
TkA08G077940	`PF08450`	SGL	257	285	0.11	12.8
TkA08G077940	`PF08450`	SGL	308	340	0.11	12.8
TkA08G077940	`PF01436`	NHL	321	329	0.00077	20.1
TkA08G077940	`PF27455`	YomR_C	421	495	0.11	13.2
TkA08G077940	`PF08450`	SGL	462	492	0.11	12.8
TkA08G077940	`PF01436`	NHL	469	483	0.00077	20.1
TkA08G077940	`PF17170`	DUF5128	471	504	0.053	13.4
TkA08G077940	`PF07550`	Shr-like_HID	612	658	0.018	16.2
TkA08G077940	`PF27455`	YomR_C	631	662	0.11	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card