TkA08G077860 | RubberDandelionOmics

Gene overview

TkA08G077860

Reference: TK1151 Chr: Chr08 Coordinates: 19949806-19953306 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2083 bp · TkA08G077860|TK1151|cDNA

AGAGGCCCATTGCTTTGGACATTTGCAATCTCATGATTTTGCATAATTAACCAAAAAATGGTCGAAGAAGCTCACACATATTTGCAATTCTCTAACACTCCACCACTCTTCTTGTTGCTACTCCATGGACAACCACCACTACCACCACCCTCCTCAGCCACCACCTCAGCTCACTCCGGCCAAAAGTTCCCGCCAACGCTACAACGAATGGATATTTCGTGATGTTCCTAGTGATATAACGGTAGAAGTGAATGGTGTTA...

CDS

Download CDS FASTA

1881 bp · TkA08G077860|TK1151|CDS

ATGGACAACCACCACTACCACCACCCTCCTCAGCCACCACCTCAGCTCACTCCGGCCAAAAGTTCCCGCCAACGCTACAACGAATGGATATTTCGTGATGTTCCTAGTGATATAACGGTAGAAGTGAATGGTGTTATGTTTCCTCTACATAAGTTCCCTCTTGTTTCTCGATGTGGCCGAATCCGAAAACTAGTAGCACAACACAGAGAAAACGCAATATCAAAAATCGAACTTCTCAGTCTCCCAGGAGGCACAGAAAC...

Protein

Download Protein FASTA

626 aa · TkA08G077860|TK1151|PROTEIN

MDNHHYHHPPQPPPQLTPAKSSRQRYNEWIFRDVPSDITVEVNGVMFPLHKFPLVSRCGRIRKLVAQHRENAISKIELLSLPGGTETFEQAAKFCYGINFEITSSNVAQLCCVSDYLEMTEQFSKRNLASRANEYLDTVVIKNLEMSVEVLKQSENLLPLTDELKIVTRCIDAIASKACVEQIASSFSRLEYSSSGRLHMSRFKGESDWWIKDLSVLRVDFYQRVMNAMKCRGVRPESIGESLMSYAEKELTGLYNLNGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G077860`
TK1151 ID	TkA08G077860
OH-1004 ID	LXL04_018681
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.800
Protein coverage (%)	TK1151 95.367 / OH-1004 91.271 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G077860

Location Chr08:19949806-19953306 (-)

Description Similar to At5g48800: BTB/POZ domain-containing protein At5g48800

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48800`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g03010`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g08570`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At2g47860`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g08660`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018681 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G03010

ath:AT2G47860

ath:AT3G08570

ath:AT3G08660

ath:AT5G48800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.539

Rank 1 · TkA08G077860 · TK1151

Cytoplasm0.354

Rank 2 · TkA08G077860 · TK1151

Cell membrane0.170

Rank 3 · TkA08G077860 · TK1151

Endoplasmic reticulum0.046

Rank 4 · TkA08G077860 · TK1151

Lysosome / Vacuole0.033

Rank 5 · TkA08G077860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00651BTB36-121 aa

PF03000NPH3114-176 aa

PF02183HALZ142-154 aa

PF03000NPH3208-471 aa

PF06156YabA534-576 aa

PF02183HALZ535-558 aa

PF29075NOCA1_mid539-578 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G077860	`PF00651`	BTB	36	121	1e-05	26.4
TkA08G077860	`PF03000`	NPH3	114	176	1.1e-91	307.8
TkA08G077860	`PF02183`	HALZ	142	154	0.53	11.2
TkA08G077860	`PF03000`	NPH3	208	471	1.1e-91	307.8
TkA08G077860	`PF06156`	YabA	534	576	0.13	13.6
TkA08G077860	`PF02183`	HALZ	535	558	0.53	11.2
TkA08G077860	`PF29075`	NOCA1_mid	539	578	0.023	15.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKB6`	Arabidopsis thaliana	sp\|Q9FKB6\|Y5880_ARATH BTB/POZ domain-containing protein At5g48800	70.300%	Swiss-Prot	High
`Q9SA69`	Arabidopsis thaliana	sp\|Q9SA69\|Y1301_ARATH BTB/POZ domain-containing protein At1g03010	45.800%	Swiss-Prot	Medium
`Q9C9Z7`	Arabidopsis thaliana	sp\|Q9C9Z7\|Y3857_ARATH BTB/POZ domain-containing protein At3g08570	47.000%	Swiss-Prot	Medium
`O82253`	Arabidopsis thaliana	sp\|O82253\|SETH6_ARATH BTB/POZ domain-containing protein SETH6	44.500%	Swiss-Prot	Medium
`Q9C9Z0`	Arabidopsis thaliana	sp\|Q9C9Z0\|Y3866_ARATH Putative BTB/POZ domain-containing protein At3g08660	44.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card